Mapoly0214s0002



Description

CCAAT-BINDING TRANSCRIPTION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005622 Intracellular
GO GO:0043565 Sequence-specific DNA binding
KOG KOG0869 CCAAT-binding factor, subunit A (HAP3)
OrthoMCL OG5_127594
PFAM PF00808 Histone-like transcription factor (CBF/NF-Y) and archaeal histone
PANTHER PTHR11064 CCAAT-BINDING TRANSCRIPTION FACTOR-RELATED
PANTHER PTHR11064:SF27

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCCAAT-NFYB1 transcription factor, CCAAT-NFYB Mapoly0214s0002.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0214s0002.1 scaffold_214:5245..7760  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0214s0002.1  

Gene structure:

mRNA scaffold_214:5245..7760  ( - strand )
three_prime_UTR scaffold_214:5245..6012  ( - strand )
CDS scaffold_214:6013..6636  ( - strand )
five_prime_UTR scaffold_214:6637..7320  ( - strand )
five_prime_UTR scaffold_214:7414..7760  ( - strand )

Sequences:

Gene

>Mapoly0214s0002.1
GCTGCTTTATCCTGAAAGAAGCTCGAGGGAAGCTGCAGTTCGTGTGCGTCTGATCATCTGCGATTGACGAGGGAGGGCGAGGCTTGATGAGCCGGGCGCGCGCTAATATATTAAAAATTTTACGGTGCGCGCGAGAGAGGCCGGAGCCGAGCTTAGAGATCCATCCTGGAGGATTGGTGGGGGGAGTGTGGAGAGTGCTATTTTAAATGCTTTAATTTGGATTTTTTTGGGGAAACAGGGTTTGCGAGGAAAAGTCTCTCGCTCTGAGAGCGAGCGGAGGGAGTGTGCTTGTTTGTCATCTGCAGAAGAGAAGCGGGATCCTATCAGAGGCTGTACCCTGGCCGCAGGTTGGTCCACAGTGAGAGGTTTTTAAGCTGTCTTGCAGATCAAGTCCCATTTGCGTGGCATTTTTAACGAGTGCGCGTTGTGTGTTTGTCCAGGCGGGATCGTCTGTGTCTGTGTGTGCGTCTGTCTGTTTGTTTTCTGCAAAAGTGCAAGTCGATTTCGCGTCGGTCGGTTCGGAGAGAGGGGGGATTGGCTGCTTTCGAGTCCTGAAGATCTGCAGGGGCCGTCGCGCGGGTCTTTACGGTCGAGAGAGGGGTCTTGCGTATGGAGCTTGGGGCGTGAGAGAAGCTGCTGGTGGTAGAGCGAGAGGGCGAGATAGCGAGAAGAGCGAGAAGAGCGAGTGGGGTACGTGAATCTGGCAGGTGTTTAGGATAATTCAATCGCTGTAGCTTGCTAGGAAGCACTCATCACCGCCGCTGCCCCGGGCGATACTGGTTGCAGGTTCGAAGTAGATGGATACTTATAAGTGACAAGGGAGGAGATTAGGAAGGAAGAAGCTCGAGGAGCACTGTTGCGACCAGGAGTAGGGGATTTGTCGACAAGATAACTCGGAGGTTCTTTACGGCCCGACGCTTCTGGCATTCTTGGGGCCTCGACTGGCAGACTGGGGCGGCTTCTAGCTGCTCAGAAAGCGCTTGTTCTTCTCTTGATTTTGACTGATTGGAGATGGGCAAGCACATTCTGTGACACGTGAACTCACAGCCCCGTGAGTTTGCAGGAACCTGCCCATAGGTGTGCTTCTAGGGTTGACGAAGAAACTTGCCCGAACGATTTGAGCGATGGCTGATTACCATCAGCAGCAGCCCGGTAGCCCGGAGAGCAGCCCTCACTCTGACAAGGAGTCCGGGGGTGGTCACTTCGGGAGCGGTCAAGATGCTTCAATTAAGGAGCAAGACAGGTTTCTCCCCATCGCAAATGTAAGTCGGATCATGAAGAAAGCGCTTCCGGCGAATGCGAAAATCTCGAAGGATGCCAAAGAAACGGTTCAAGAATGCGTGTCTGAGTTCATCAGTTTCATCACTGGAGAGGCCTCTGACAAGTGCCAGAGGGAGAAACGGAAGACAATCAATGGCGACGATCTTCTGTGGGCAATGAGCACGCTGGGTTTCGAAGACTACGTCGAACCGTTGAAGGTGTACCTGCACAAGTACCGCGAGACGGAAGGAGAGAAGGCCTCCATGGCCAAACAGGGTGATCAGTCGGTAGTGAAGGACGGGAGCAGCGGGATGAACGGCAACGTGAATGGCATGAACGGTGGGATGAACGGAACGATGCAAGGTTCGATGCAGATGATGCAATCCTACCAGCCCCAGCCTGGAATGATGTACAGTCATCAACAGATGATGGGGAATCCATACCAGATGTCCATGCAGAGCCAAGGAGGTCAGTCACGAGGCATGTGAAACCCAGATCCAAGGAATGAAGCTGTGCATAGACGTTAGGTGCTGGATTGATACGAAAAGCTAGATGAAGGAAGGGGGAGGAAAGGAAGGTAGGCAATCAGAACTGCATGTACATTCTGGAGGTGCACGAACTGCAATTGAAAGTGCTCTTCGCAGAGATTATGTGCAGTTTTGTCTTTCCGCCCTGTGCTGCAGCCGTTAAAGCTAGGAAGGAAGGAAGCAGATGTTTAGATGGAGACTAGTCCTCGCAGGATTGAGGGAAAACCGTTAACCCGTTTGGAACAGACGGGTTGAATGACTGTATAAAAGGTTGAAATTTTGGAGTGATTTTCTTGACTCTGGAAATCTCTTTGAAGCACTATAGCCGTAGTGTGGGCAGCACCTTACATCCTCTTAGAAGGTTCTTTTAGACAGTATTTGGTACAGTTTTAGAAGATTTTTTTGGAAAGGACTATCCACTGTCAAGACCATGAGCTCTTTTGGTACAGCGCGCGAAGAAGATCTGCTTTGTTTTGGTAACGGTTCGGATGCAGGGCGGCAGGTTCCGAGTGGATTCAGGAAGTGTAGATTGGGGGGCCTTGGTAGAGCACTTTGCATCCAGGACCTTTCTCTTTTTTCTTGGATGGGATCTCTGGATTGAACGGTAGCTCAATCGGCAAGGTTGTGGCTGTAATTAGCCTGATATCTTCGAACGATTCTTGTTTCTTGTAAGAAGAATTTCTTCTTTGTAAGTCTTTTTGTTATTGAAGCCCCTTGTCTCTTGGAAAT

mRNA

>Mapoly0214s0002.1
GCTGCTTTATCCTGAAAGAAGCTCGAGGGAAGCTGCAGTTCGTGTGCGTCTGATCATCTGCGATTGACGAGGGAGGGCGAGGCTTGATGAGCCGGGCGCGCGCTAATATATTAAAAATTTTACGGTGCGCGCGAGAGAGGCCGGAGCCGAGCTTAGAGATCCATCCTGGAGGATTGGTGGGGGGAGTGTGGAGAGTGCTATTTTAAATGCTTTAATTTGGATTTTTTTGGGGAAACAGGGTTTGCGAGGAAAAGTCTCTCGCTCTGAGAGCGAGCGGAGGGAGTGTGCTTGTTTGTCATCTGCAGAAGAGAAGCGGGATCCTATCAGAGGCTGTACCCTGGCCGCAGGCGGGATCGTCTGTGTCTGTGTGTGCGTCTGTCTGTTTGTTTTCTGCAAAAGTGCAAGTCGATTTCGCGTCGGTCGGTTCGGAGAGAGGGGGGATTGGCTGCTTTCGAGTCCTGAAGATCTGCAGGGGCCGTCGCGCGGGTCTTTACGGTCGAGAGAGGGGTCTTGCGTATGGAGCTTGGGGCGTGAGAGAAGCTGCTGGTGGTAGAGCGAGAGGGCGAGATAGCGAGAAGAGCGAGAAGAGCGAGTGGGGTACGTGAATCTGGCAGGTGTTTAGGATAATTCAATCGCTGTAGCTTGCTAGGAAGCACTCATCACCGCCGCTGCCCCGGGCGATACTGGTTGCAGGTTCGAAGTAGATGGATACTTATAAGTGACAAGGGAGGAGATTAGGAAGGAAGAAGCTCGAGGAGCACTGTTGCGACCAGGAGTAGGGGATTTGTCGACAAGATAACTCGGAGGTTCTTTACGGCCCGACGCTTCTGGCATTCTTGGGGCCTCGACTGGCAGACTGGGGCGGCTTCTAGCTGCTCAGAAAGCGCTTGTTCTTCTCTTGATTTTGACTGATTGGAGATGGGCAAGCACATTCTGTGACACGTGAACTCACAGCCCCGTGAGTTTGCAGGAACCTGCCCATAGGTGTGCTTCTAGGGTTGACGAAGAAACTTGCCCGAACGATTTGAGCGATGGCTGATTACCATCAGCAGCAGCCCGGTAGCCCGGAGAGCAGCCCTCACTCTGACAAGGAGTCCGGGGGTGGTCACTTCGGGAGCGGTCAAGATGCTTCAATTAAGGAGCAAGACAGGTTTCTCCCCATCGCAAATGTAAGTCGGATCATGAAGAAAGCGCTTCCGGCGAATGCGAAAATCTCGAAGGATGCCAAAGAAACGGTTCAAGAATGCGTGTCTGAGTTCATCAGTTTCATCACTGGAGAGGCCTCTGACAAGTGCCAGAGGGAGAAACGGAAGACAATCAATGGCGACGATCTTCTGTGGGCAATGAGCACGCTGGGTTTCGAAGACTACGTCGAACCGTTGAAGGTGTACCTGCACAAGTACCGCGAGACGGAAGGAGAGAAGGCCTCCATGGCCAAACAGGGTGATCAGTCGGTAGTGAAGGACGGGAGCAGCGGGATGAACGGCAACGTGAATGGCATGAACGGTGGGATGAACGGAACGATGCAAGGTTCGATGCAGATGATGCAATCCTACCAGCCCCAGCCTGGAATGATGTACAGTCATCAACAGATGATGGGGAATCCATACCAGATGTCCATGCAGAGCCAAGGAGGTCAGTCACGAGGCATGTGAAACCCAGATCCAAGGAATGAAGCTGTGCATAGACGTTAGGTGCTGGATTGATACGAAAAGCTAGATGAAGGAAGGGGGAGGAAAGGAAGGTAGGCAATCAGAACTGCATGTACATTCTGGAGGTGCACGAACTGCAATTGAAAGTGCTCTTCGCAGAGATTATGTGCAGTTTTGTCTTTCCGCCCTGTGCTGCAGCCGTTAAAGCTAGGAAGGAAGGAAGCAGATGTTTAGATGGAGACTAGTCCTCGCAGGATTGAGGGAAAACCGTTAACCCGTTTGGAACAGACGGGTTGAATGACTGTATAAAAGGTTGAAATTTTGGAGTGATTTTCTTGACTCTGGAAATCTCTTTGAAGCACTATAGCCGTAGTGTGGGCAGCACCTTACATCCTCTTAGAAGGTTCTTTTAGACAGTATTTGGTACAGTTTTAGAAGATTTTTTTGGAAAGGACTATCCACTGTCAAGACCATGAGCTCTTTTGGTACAGCGCGCGAAGAAGATCTGCTTTGTTTTGGTAACGGTTCGGATGCAGGGCGGCAGGTTCCGAGTGGATTCAGGAAGTGTAGATTGGGGGGCCTTGGTAGAGCACTTTGCATCCAGGACCTTTCTCTTTTTTCTTGGATGGGATCTCTGGATTGAACGGTAGCTCAATCGGCAAGGTTGTGGCTGTAATTAGCCTGATATCTTCGAACGATTCTTGTTTCTTGTAAGAAGAATTTCTTCTTTGTAAGTCTTTTTGTTATTGAAGCCCCTTGTCTCTTGGAAAT

CDS

>Mapoly0214s0002.1
ATGGCTGATTACCATCAGCAGCAGCCCGGTAGCCCGGAGAGCAGCCCTCACTCTGACAAGGAGTCCGGGGGTGGTCACTTCGGGAGCGGTCAAGATGCTTCAATTAAGGAGCAAGACAGGTTTCTCCCCATCGCAAATGTAAGTCGGATCATGAAGAAAGCGCTTCCGGCGAATGCGAAAATCTCGAAGGATGCCAAAGAAACGGTTCAAGAATGCGTGTCTGAGTTCATCAGTTTCATCACTGGAGAGGCCTCTGACAAGTGCCAGAGGGAGAAACGGAAGACAATCAATGGCGACGATCTTCTGTGGGCAATGAGCACGCTGGGTTTCGAAGACTACGTCGAACCGTTGAAGGTGTACCTGCACAAGTACCGCGAGACGGAAGGAGAGAAGGCCTCCATGGCCAAACAGGGTGATCAGTCGGTAGTGAAGGACGGGAGCAGCGGGATGAACGGCAACGTGAATGGCATGAACGGTGGGATGAACGGAACGATGCAAGGTTCGATGCAGATGATGCAATCCTACCAGCCCCAGCCTGGAATGATGTACAGTCATCAACAGATGATGGGGAATCCATACCAGATGTCCATGCAGAGCCAAGGAGGTCAGTCACGAGGCATGTGA

Protein

>Mapoly0214s0002.1
MADYHQQQPGSPESSPHSDKESGGGHFGSGQDASIKEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYRETEGEKASMAKQGDQSVVKDGSSGMNGNVNGMNGGMNGTMQGSMQMMQSYQPQPGMMYSHQQMMGNPYQMSMQSQGGQSRGM

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>