Mapoly0216s0010



Description

CCAAT-binding factor, subunit A (HAP3)

Reference DB

Database ID Description
GO GO:0005622 Intracellular
GO GO:0043565 Sequence-specific DNA binding
KOG KOG0869 CCAAT-binding factor, subunit A (HAP3)
OrthoMCL OG5_127594
PFAM PF00808 Histone-like transcription factor (CBF/NF-Y) and archaeal histone
PANTHER PTHR11064 CCAAT-BINDING TRANSCRIPTION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCCAAT-NFYB2 transcription factor, CCAAT-NFYB Mapoly0216s0010.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0216s0010.1 scaffold_216:96661..99705  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0216s0010.2 scaffold_216:96635..99705  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0216s0010.3 scaffold_216:96682..99705  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0216s0010.4 scaffold_216:97123..99705  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0216s0010.1  

Gene structure:

mRNA scaffold_216:96661..99705  ( + strand )
five_prime_UTR scaffold_216:96661..97303  ( + strand )
five_prime_UTR scaffold_216:97603..97611  ( + strand )
CDS scaffold_216:97612..97847  ( + strand )
CDS scaffold_216:98060..98189  ( + strand )
CDS scaffold_216:98360..98365  ( + strand )
CDS scaffold_216:98496..98579  ( + strand )
CDS scaffold_216:98859..98909  ( + strand )
CDS scaffold_216:99050..99076  ( + strand )
CDS scaffold_216:99189..99236  ( + strand )
three_prime_UTR scaffold_216:99237..99705  ( + strand )

Sequences:

Gene

>Mapoly0216s0010.1
GCATAACCGGGGCCGGGGATCCGCGGTCAAACAGAAGTCGACCCCGAGACTCTGGAGGTTGTTTTTGGAGAAACCAGACCCAGGTCCCAGGGTGGGGATACCGCTGAAAAGCAGACGCCGTGTGTGCTGAAGGTTGTAATAGACGGATGAACGGTTCGGATAGACGCTAAGGGGAGAGCCGATCGTCGTGGTGCACGGGGCACAACGAGGAGCATCGGAAGCGAGCATTGTTGGAGTGAAGCAAACAGCAAACAGCAGCAGAAGTACCAGCGGCGAACGACGACAACTTGACTATTTTCATCAGCCACTGACTGGTGGCTTCATTGTTACGACGCTTGTTACGAACACACATAAGGCAAGCGAATGAGTAGTTGTAAACAGCCATGCATGATTTTCTCACAGGGCAGTCCAGGCAGTGGTGAAGGCAGAAAGAAGGGAGGCACGGATTGGATTGGATTTCGCATGTCGTTTTTTAATATGTTCTCTCTGTGTGACCCATCCACTCGGATTCCTCTGTAGACAGAAATAAGCATGCGTGTTTCGAATGTAAATATTCGAAACTGGTTGGGGGTGAGCCAGAAAAAGCGCGCTCTTGCGCGCTCTTTCTCCTCCCTTCGACAGATTTCAACAAATTTCAAACTCTGTAATTTTCTTCCCTCGTTTATTTCTCCAACAGCCCGTTTGTTCAGTTCATCTTACTCGAACATTTCTCTTCGGCTCTTGTCACTGCAACACTATCTGTTGATATCGCTTGACACAAATTAAGCAAGACACGCGCAGGACTATGTTTTATCAACAGCAACACGTAGAATACATGCGCTAGGTGTACAAGAATGTGACTGCCTGTTCCTGATTATCTCTAAAGCTGCATGTTGAATACATGTTGCGTAAGCGCTCGCAAGATGATGAAATATTTGACATGCAGTTTCTTGACCTCGACAGGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAGTATGTGGAAAATCGACTAACTTTCTATTTTGTAGTCTGCTTTTGTCTTTGATTACAATCTGATGTTAGTTAAATCGCAGGGTTGAATTTTCTGTGGTCTGATGTGGGAATGTAAGCTAGCTGCGGAAATGTACAAATGACATATATCCCGACAGATCATTCAATTCAGTTTTTGCATATTACTGATTCCCTTTTTAAAATTTCCTACGCAGAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGGTATCAATATACTCCGTCTTTAGGGTTTCTAAAAGCTCTTTGTGAATGTTAGTCTTTGCAACTGAAATATTAGTTTGTTACAGTTTTACAGTCGACAAAAAATACAACTGACAGTTTGTATTCTTTGTGTTTGGGTACCTGCCCGTTGATACGACTTCTCTCTTCTCAAGATGGAGGTGAGCCTCCTTATTTCCTTGATGTGTTCATTCAGGCTGATGCGAAGCGTCTTGTATTTACAGTTAATATCCTCTGCTTCTGACTTCCTTTGAAGATTGACAGTTTTTAACATGGAAGAAGTAATTTCAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGGTAACCCTTTCACCTTTCTAACTTTTTATGTTTGTATTCAGATACAGTTGCCAAAGTTCTGTTGTTCTGGTCTGTTGTATGAATGTTACCTGGGAATTGGATTCAAGGATCCCATTCGCTCGAGGAGTATGATTATGATCATATTGGGTGAGTCATGAATTGAGAAATTTCAAAACAGAAGAGACTCGTTTCTTTCTCAACACATCCACTCATTCACATCAGATTGCTTTATGGTTTTAGTCAGTTGGGACTAAGAAAACCTTTTCTGACTTTTCTCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGGTGCGTAGTAACTCCTAAGAGAATCTGATAGTAATCTTACTCTTATGAATCGCAGATTAAACTCAGCTTAGGTTTTCGTGATTGTCAATCTTCTCAATTAGGTGTTCCATTTCACATGTATTTTCTGTTGTTCTTTGCAGATGATGAGTGCACCTCCTAACTATCAGGTAAACATGTTGACTGTTGTTATGCTTTTTTCGTTGCAATTATATTGTCTGTCCAGTCTGATGTTTTCCGTGTAACATATCTCCAACTGACACCGATTATTGTGGTCTGTAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

mRNA

>Mapoly0216s0010.1
GCATAACCGGGGCCGGGGATCCGCGGTCAAACAGAAGTCGACCCCGAGACTCTGGAGGTTGTTTTTGGAGAAACCAGACCCAGGTCCCAGGGTGGGGATACCGCTGAAAAGCAGACGCCGTGTGTGCTGAAGGTTGTAATAGACGGATGAACGGTTCGGATAGACGCTAAGGGGAGAGCCGATCGTCGTGGTGCACGGGGCACAACGAGGAGCATCGGAAGCGAGCATTGTTGGAGTGAAGCAAACAGCAAACAGCAGCAGAAGTACCAGCGGCGAACGACGACAACTTGACTATTTTCATCAGCCACTGACTGGTGGCTTCATTGTTACGACGCTTGTTACGAACACACATAAGGCAAGCGAATGAGTAGTTGTAAACAGCCATGCATGATTTTCTCACAGGGCAGTCCAGGCAGTGGTGAAGGCAGAAAGAAGGGAGGCACGGATTGGATTGGATTTCGCATGTCGTTTTTTAATATGTTCTCTCTGTGTGACCCATCCACTCGGATTCCTCTGTAGACAGAAATAAGCATGCGTGTTTCGAATGTAAATATTCGAAACTGGTTGGGGGTGAGCCAGAAAAAGCGCGCTCTTGCGCGCTCTTTCTCCTCCCTTCGACAGATTTCAACAAATTTCAAACTCTGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

CDS

>Mapoly0216s0010.1
ATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGA

Protein

>Mapoly0216s0010.1
MAGTSSPGSQDNSHSDDFGNAGGGDRDNSNVREQDRFLPIANISRIMKKALPVNAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYREMEGDKGSSINKPGESNSGKKEGTSHPAVQQMSAGVQAYNMGYNIQNQMMSAPPNYQLQMQQMLAAPGGQQH

Mapoly0216s0010.2  

Gene structure:

mRNA scaffold_216:96635..99705  ( + strand )
five_prime_UTR scaffold_216:96635..97015  ( + strand )
five_prime_UTR scaffold_216:97603..97611  ( + strand )
CDS scaffold_216:97612..97847  ( + strand )
CDS scaffold_216:98060..98189  ( + strand )
CDS scaffold_216:98360..98365  ( + strand )
CDS scaffold_216:98496..98579  ( + strand )
CDS scaffold_216:98859..98909  ( + strand )
CDS scaffold_216:99050..99076  ( + strand )
CDS scaffold_216:99195..99236  ( + strand )
three_prime_UTR scaffold_216:99237..99705  ( + strand )

Sequences:

Gene

>Mapoly0216s0010.2
CAGTTGGCAAGGAAAGAATAGTAAACGCATAACCGGGGCCGGGGATCCGCGGTCAAACAGAAGTCGACCCCGAGACTCTGGAGGTTGTTTTTGGAGAAACCAGACCCAGGTCCCAGGGTGGGGATACCGCTGAAAAGCAGACGCCGTGTGTGCTGAAGGTTGTAATAGACGGATGAACGGTTCGGATAGACGCTAAGGGGAGAGCCGATCGTCGTGGTGCACGGGGCACAACGAGGAGCATCGGAAGCGAGCATTGTTGGAGTGAAGCAAACAGCAAACAGCAGCAGAAGTACCAGCGGCGAACGACGACAACTTGACTATTTTCATCAGCCACTGACTGGTGGCTTCATTGTTACGACGCTTGTTACGAACACACATAAGGCAAGCGAATGAGTAGTTGTAAACAGCCATGCATGATTTTCTCACAGGGCAGTCCAGGCAGTGGTGAAGGCAGAAAGAAGGGAGGCACGGATTGGATTGGATTTCGCATGTCGTTTTTTAATATGTTCTCTCTGTGTGACCCATCCACTCGGATTCCTCTGTAGACAGAAATAAGCATGCGTGTTTCGAATGTAAATATTCGAAACTGGTTGGGGGTGAGCCAGAAAAAGCGCGCTCTTGCGCGCTCTTTCTCCTCCCTTCGACAGATTTCAACAAATTTCAAACTCTGTAATTTTCTTCCCTCGTTTATTTCTCCAACAGCCCGTTTGTTCAGTTCATCTTACTCGAACATTTCTCTTCGGCTCTTGTCACTGCAACACTATCTGTTGATATCGCTTGACACAAATTAAGCAAGACACGCGCAGGACTATGTTTTATCAACAGCAACACGTAGAATACATGCGCTAGGTGTACAAGAATGTGACTGCCTGTTCCTGATTATCTCTAAAGCTGCATGTTGAATACATGTTGCGTAAGCGCTCGCAAGATGATGAAATATTTGACATGCAGTTTCTTGACCTCGACAGGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAGTATGTGGAAAATCGACTAACTTTCTATTTTGTAGTCTGCTTTTGTCTTTGATTACAATCTGATGTTAGTTAAATCGCAGGGTTGAATTTTCTGTGGTCTGATGTGGGAATGTAAGCTAGCTGCGGAAATGTACAAATGACATATATCCCGACAGATCATTCAATTCAGTTTTTGCATATTACTGATTCCCTTTTTAAAATTTCCTACGCAGAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGGTATCAATATACTCCGTCTTTAGGGTTTCTAAAAGCTCTTTGTGAATGTTAGTCTTTGCAACTGAAATATTAGTTTGTTACAGTTTTACAGTCGACAAAAAATACAACTGACAGTTTGTATTCTTTGTGTTTGGGTACCTGCCCGTTGATACGACTTCTCTCTTCTCAAGATGGAGGTGAGCCTCCTTATTTCCTTGATGTGTTCATTCAGGCTGATGCGAAGCGTCTTGTATTTACAGTTAATATCCTCTGCTTCTGACTTCCTTTGAAGATTGACAGTTTTTAACATGGAAGAAGTAATTTCAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGGTAACCCTTTCACCTTTCTAACTTTTTATGTTTGTATTCAGATACAGTTGCCAAAGTTCTGTTGTTCTGGTCTGTTGTATGAATGTTACCTGGGAATTGGATTCAAGGATCCCATTCGCTCGAGGAGTATGATTATGATCATATTGGGTGAGTCATGAATTGAGAAATTTCAAAACAGAAGAGACTCGTTTCTTTCTCAACACATCCACTCATTCACATCAGATTGCTTTATGGTTTTAGTCAGTTGGGACTAAGAAAACCTTTTCTGACTTTTCTCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGGTGCGTAGTAACTCCTAAGAGAATCTGATAGTAATCTTACTCTTATGAATCGCAGATTAAACTCAGCTTAGGTTTTCGTGATTGTCAATCTTCTCAATTAGGTGTTCCATTTCACATGTATTTTCTGTTGTTCTTTGCAGATGATGAGTGCACCTCCTAACTATCAGGTAAACATGTTGACTGTTGTTATGCTTTTTTCGTTGCAATTATATTGTCTGTCCAGTCTGATGTTTTCCGTGTAACATATCTCCAACTGACACCGATTATTGTGGTCTGTAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

mRNA

>Mapoly0216s0010.2
CAGTTGGCAAGGAAAGAATAGTAAACGCATAACCGGGGCCGGGGATCCGCGGTCAAACAGAAGTCGACCCCGAGACTCTGGAGGTTGTTTTTGGAGAAACCAGACCCAGGTCCCAGGGTGGGGATACCGCTGAAAAGCAGACGCCGTGTGTGCTGAAGGTTGTAATAGACGGATGAACGGTTCGGATAGACGCTAAGGGGAGAGCCGATCGTCGTGGTGCACGGGGCACAACGAGGAGCATCGGAAGCGAGCATTGTTGGAGTGAAGCAAACAGCAAACAGCAGCAGAAGTACCAGCGGCGAACGACGACAACTTGACTATTTTCATCAGCCACTGACTGGTGGCTTCATTGTTACGACGCTTGTTACGAACACACATAAGGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

CDS

>Mapoly0216s0010.2
ATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGA

Protein

>Mapoly0216s0010.2
MAGTSSPGSQDNSHSDDFGNAGGGDRDNSNVREQDRFLPIANISRIMKKALPVNAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYREMEGDKGSSINKPGESNSGKKEGTSHPAVQQMSAGVQAYNMGYNIQNQMMSAPPNYQMQQMLAAPGGQQH

Mapoly0216s0010.3  

Gene structure:

mRNA scaffold_216:96682..99705  ( + strand )
five_prime_UTR scaffold_216:96682..97015  ( + strand )
five_prime_UTR scaffold_216:97603..97611  ( + strand )
CDS scaffold_216:97612..97847  ( + strand )
CDS scaffold_216:98060..98189  ( + strand )
CDS scaffold_216:98360..98365  ( + strand )
CDS scaffold_216:98496..98579  ( + strand )
CDS scaffold_216:98859..98909  ( + strand )
CDS scaffold_216:99050..99076  ( + strand )
CDS scaffold_216:99189..99236  ( + strand )
three_prime_UTR scaffold_216:99237..99705  ( + strand )

Sequences:

Gene

>Mapoly0216s0010.3
CGCGGTCAAACAGAAGTCGACCCCGAGACTCTGGAGGTTGTTTTTGGAGAAACCAGACCCAGGTCCCAGGGTGGGGATACCGCTGAAAAGCAGACGCCGTGTGTGCTGAAGGTTGTAATAGACGGATGAACGGTTCGGATAGACGCTAAGGGGAGAGCCGATCGTCGTGGTGCACGGGGCACAACGAGGAGCATCGGAAGCGAGCATTGTTGGAGTGAAGCAAACAGCAAACAGCAGCAGAAGTACCAGCGGCGAACGACGACAACTTGACTATTTTCATCAGCCACTGACTGGTGGCTTCATTGTTACGACGCTTGTTACGAACACACATAAGGCAAGCGAATGAGTAGTTGTAAACAGCCATGCATGATTTTCTCACAGGGCAGTCCAGGCAGTGGTGAAGGCAGAAAGAAGGGAGGCACGGATTGGATTGGATTTCGCATGTCGTTTTTTAATATGTTCTCTCTGTGTGACCCATCCACTCGGATTCCTCTGTAGACAGAAATAAGCATGCGTGTTTCGAATGTAAATATTCGAAACTGGTTGGGGGTGAGCCAGAAAAAGCGCGCTCTTGCGCGCTCTTTCTCCTCCCTTCGACAGATTTCAACAAATTTCAAACTCTGTAATTTTCTTCCCTCGTTTATTTCTCCAACAGCCCGTTTGTTCAGTTCATCTTACTCGAACATTTCTCTTCGGCTCTTGTCACTGCAACACTATCTGTTGATATCGCTTGACACAAATTAAGCAAGACACGCGCAGGACTATGTTTTATCAACAGCAACACGTAGAATACATGCGCTAGGTGTACAAGAATGTGACTGCCTGTTCCTGATTATCTCTAAAGCTGCATGTTGAATACATGTTGCGTAAGCGCTCGCAAGATGATGAAATATTTGACATGCAGTTTCTTGACCTCGACAGGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAGTATGTGGAAAATCGACTAACTTTCTATTTTGTAGTCTGCTTTTGTCTTTGATTACAATCTGATGTTAGTTAAATCGCAGGGTTGAATTTTCTGTGGTCTGATGTGGGAATGTAAGCTAGCTGCGGAAATGTACAAATGACATATATCCCGACAGATCATTCAATTCAGTTTTTGCATATTACTGATTCCCTTTTTAAAATTTCCTACGCAGAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGGTATCAATATACTCCGTCTTTAGGGTTTCTAAAAGCTCTTTGTGAATGTTAGTCTTTGCAACTGAAATATTAGTTTGTTACAGTTTTACAGTCGACAAAAAATACAACTGACAGTTTGTATTCTTTGTGTTTGGGTACCTGCCCGTTGATACGACTTCTCTCTTCTCAAGATGGAGGTGAGCCTCCTTATTTCCTTGATGTGTTCATTCAGGCTGATGCGAAGCGTCTTGTATTTACAGTTAATATCCTCTGCTTCTGACTTCCTTTGAAGATTGACAGTTTTTAACATGGAAGAAGTAATTTCAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGGTAACCCTTTCACCTTTCTAACTTTTTATGTTTGTATTCAGATACAGTTGCCAAAGTTCTGTTGTTCTGGTCTGTTGTATGAATGTTACCTGGGAATTGGATTCAAGGATCCCATTCGCTCGAGGAGTATGATTATGATCATATTGGGTGAGTCATGAATTGAGAAATTTCAAAACAGAAGAGACTCGTTTCTTTCTCAACACATCCACTCATTCACATCAGATTGCTTTATGGTTTTAGTCAGTTGGGACTAAGAAAACCTTTTCTGACTTTTCTCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGGTGCGTAGTAACTCCTAAGAGAATCTGATAGTAATCTTACTCTTATGAATCGCAGATTAAACTCAGCTTAGGTTTTCGTGATTGTCAATCTTCTCAATTAGGTGTTCCATTTCACATGTATTTTCTGTTGTTCTTTGCAGATGATGAGTGCACCTCCTAACTATCAGGTAAACATGTTGACTGTTGTTATGCTTTTTTCGTTGCAATTATATTGTCTGTCCAGTCTGATGTTTTCCGTGTAACATATCTCCAACTGACACCGATTATTGTGGTCTGTAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

mRNA

>Mapoly0216s0010.3
CGCGGTCAAACAGAAGTCGACCCCGAGACTCTGGAGGTTGTTTTTGGAGAAACCAGACCCAGGTCCCAGGGTGGGGATACCGCTGAAAAGCAGACGCCGTGTGTGCTGAAGGTTGTAATAGACGGATGAACGGTTCGGATAGACGCTAAGGGGAGAGCCGATCGTCGTGGTGCACGGGGCACAACGAGGAGCATCGGAAGCGAGCATTGTTGGAGTGAAGCAAACAGCAAACAGCAGCAGAAGTACCAGCGGCGAACGACGACAACTTGACTATTTTCATCAGCCACTGACTGGTGGCTTCATTGTTACGACGCTTGTTACGAACACACATAAGGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

CDS

>Mapoly0216s0010.3
ATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGA

Protein

>Mapoly0216s0010.3
MAGTSSPGSQDNSHSDDFGNAGGGDRDNSNVREQDRFLPIANISRIMKKALPVNAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYREMEGDKGSSINKPGESNSGKKEGTSHPAVQQMSAGVQAYNMGYNIQNQMMSAPPNYQLQMQQMLAAPGGQQH

Mapoly0216s0010.4  

Gene structure:

mRNA scaffold_216:97123..99705  ( + strand )
five_prime_UTR scaffold_216:97123..97303  ( + strand )
five_prime_UTR scaffold_216:97603..97611  ( + strand )
CDS scaffold_216:97612..97847  ( + strand )
CDS scaffold_216:98060..98189  ( + strand )
CDS scaffold_216:98360..98365  ( + strand )
CDS scaffold_216:98496..98579  ( + strand )
CDS scaffold_216:98859..98909  ( + strand )
CDS scaffold_216:99050..99076  ( + strand )
CDS scaffold_216:99195..99236  ( + strand )
three_prime_UTR scaffold_216:99237..99705  ( + strand )

Sequences:

Gene

>Mapoly0216s0010.4
ATGTCGTTTTTTAATATGTTCTCTCTGTGTGACCCATCCACTCGGATTCCTCTGTAGACAGAAATAAGCATGCGTGTTTCGAATGTAAATATTCGAAACTGGTTGGGGGTGAGCCAGAAAAAGCGCGCTCTTGCGCGCTCTTTCTCCTCCCTTCGACAGATTTCAACAAATTTCAAACTCTGTAATTTTCTTCCCTCGTTTATTTCTCCAACAGCCCGTTTGTTCAGTTCATCTTACTCGAACATTTCTCTTCGGCTCTTGTCACTGCAACACTATCTGTTGATATCGCTTGACACAAATTAAGCAAGACACGCGCAGGACTATGTTTTATCAACAGCAACACGTAGAATACATGCGCTAGGTGTACAAGAATGTGACTGCCTGTTCCTGATTATCTCTAAAGCTGCATGTTGAATACATGTTGCGTAAGCGCTCGCAAGATGATGAAATATTTGACATGCAGTTTCTTGACCTCGACAGGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAGTATGTGGAAAATCGACTAACTTTCTATTTTGTAGTCTGCTTTTGTCTTTGATTACAATCTGATGTTAGTTAAATCGCAGGGTTGAATTTTCTGTGGTCTGATGTGGGAATGTAAGCTAGCTGCGGAAATGTACAAATGACATATATCCCGACAGATCATTCAATTCAGTTTTTGCATATTACTGATTCCCTTTTTAAAATTTCCTACGCAGAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGGTATCAATATACTCCGTCTTTAGGGTTTCTAAAAGCTCTTTGTGAATGTTAGTCTTTGCAACTGAAATATTAGTTTGTTACAGTTTTACAGTCGACAAAAAATACAACTGACAGTTTGTATTCTTTGTGTTTGGGTACCTGCCCGTTGATACGACTTCTCTCTTCTCAAGATGGAGGTGAGCCTCCTTATTTCCTTGATGTGTTCATTCAGGCTGATGCGAAGCGTCTTGTATTTACAGTTAATATCCTCTGCTTCTGACTTCCTTTGAAGATTGACAGTTTTTAACATGGAAGAAGTAATTTCAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGGTAACCCTTTCACCTTTCTAACTTTTTATGTTTGTATTCAGATACAGTTGCCAAAGTTCTGTTGTTCTGGTCTGTTGTATGAATGTTACCTGGGAATTGGATTCAAGGATCCCATTCGCTCGAGGAGTATGATTATGATCATATTGGGTGAGTCATGAATTGAGAAATTTCAAAACAGAAGAGACTCGTTTCTTTCTCAACACATCCACTCATTCACATCAGATTGCTTTATGGTTTTAGTCAGTTGGGACTAAGAAAACCTTTTCTGACTTTTCTCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGGTGCGTAGTAACTCCTAAGAGAATCTGATAGTAATCTTACTCTTATGAATCGCAGATTAAACTCAGCTTAGGTTTTCGTGATTGTCAATCTTCTCAATTAGGTGTTCCATTTCACATGTATTTTCTGTTGTTCTTTGCAGATGATGAGTGCACCTCCTAACTATCAGGTAAACATGTTGACTGTTGTTATGCTTTTTTCGTTGCAATTATATTGTCTGTCCAGTCTGATGTTTTCCGTGTAACATATCTCCAACTGACACCGATTATTGTGGTCTGTAGCTACAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

mRNA

>Mapoly0216s0010.4
ATGTCGTTTTTTAATATGTTCTCTCTGTGTGACCCATCCACTCGGATTCCTCTGTAGACAGAAATAAGCATGCGTGTTTCGAATGTAAATATTCGAAACTGGTTGGGGGTGAGCCAGAAAAAGCGCGCTCTTGCGCGCTCTTTCTCCTCCCTTCGACAGATTTCAACAAATTTCAAACTCTGTTGAATTGATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGATTCATGTCGATATAGTAGTAGGGATAGGTCTTTGCTTAGGTCTGCGCGGAGATTTGTAGACAACTGTTCCCCTAATCCGCGAAAAGCAAATGGAAAAGACTAGCATATCCAAGTAGGGGAGCTTGGAAAATGGCTAGGTTGTGCTAACCTCTGAGTAGCTGAAGACTTCAATCTTGGTAATTTCTTTCAACTTGTAGTGATACATTCTGGCTAACCTCACAGGTTCGGAAAGTTTTTCCTTTCCTCAAGTTCTTTCGGATCCCTGCTTAGAGCTTTCTTTGTGCAGGCGCTTTCTGTTATTTTTGGTATGTGAAGGTCTGAGTTTTTCTCATCCAAAAAGTATGTAAATAGAGGTTTTGAATACGGATTGACGGGTCTAAGGGTAGGAGTCACTGGTTTTACCCTGATTGTATCACTTGAATGTTGTCAACTCAAAGTTTCATACATAAAAAAAACTCGTTCTTTTCCC

CDS

>Mapoly0216s0010.4
ATGGCCGGGACTTCTAGTCCAGGGAGTCAGGACAACTCCCACTCTGACGACTTTGGCAACGCTGGCGGAGGAGACCGTGACAATTCCAATGTCAGAGAGCAGGATCGATTTCTCCCGATAGCAAATATCAGCAGAATTATGAAGAAAGCGCTTCCTGTAAACGCCAAGATTGCGAAGGACGCCAAAGAAACTGTGCAGGAATGCGTCTCAGAGTTTATAAGCTTCATCACAAGCGAAGCTTCTGACAAATGTCAGAGAGAAAAGAGAAAAACTATAAATGGAGATGATCTATTGTGGGCCATGAGCACATTAGGGTTCGAAGATTATGTTGAACCCTTGAAGGTGTATCTGCACAAGTATCGAGAGATGGAGGGAGATAAGGGCTCTTCAATTAATAAGCCGGGAGAGTCCAACTCCGGAAAAAAAGAGGGAACAAGTCACCCTGCTGTTCAGCAGATGAGCGCTGGCGTTCAAGCCTACAACATGGGCTATAATATACAAAATCAGATGATGAGTGCACCTCCTAACTATCAGATGCAGCAGATGCTGGCCGCTCCGGGAGGTCAACAACATTGA

Protein

>Mapoly0216s0010.4
MAGTSSPGSQDNSHSDDFGNAGGGDRDNSNVREQDRFLPIANISRIMKKALPVNAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYREMEGDKGSSINKPGESNSGKKEGTSHPAVQQMSAGVQAYNMGYNIQNQMMSAPPNYQMQQMLAAPGGQQH

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>