Mapoly0224s0005



Description

ADP-ribosylation factor-like 2

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KEGGORTH K07943 ADP-ribosylation factor-like 2
KOG KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2
OrthoMCL OG5_128319
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED
PANTHER PTHR11711:SF26 ADP-RIBOSYLATION FACTOR-LIKE 2, ARL2

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFLC SAR/ARF GTPase Mapoly0224s0005.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0224s0005.1 scaffold_224:36114..39538  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0224s0005.1  

Gene structure:

mRNA scaffold_224:36114..39538  ( - strand )
three_prime_UTR scaffold_224:36114..37013  ( - strand )
CDS scaffold_224:37014..37151  ( - strand )
CDS scaffold_224:37373..37453  ( - strand )
CDS scaffold_224:37791..37953  ( - strand )
CDS scaffold_224:38495..38605  ( - strand )
CDS scaffold_224:38786..38850  ( - strand )
five_prime_UTR scaffold_224:38851..39538  ( - strand )

Sequences:

Gene

>Mapoly0224s0005.1
TTTGTGACAAAGGCATCGCTCGGCCCTTAAACAAGGCGAAGAACTCCGTGACACAAAGAAGACTTTCGTCTTGGCTGCAGTACAGGCAACGCATTTAACTTGGAGACATGACTCTCGGAGACTCAGGGATGGGACTCGGGTTAACGACCTGGACAAGTAGAGCTTCTGTAGCCTGTTAGCGGATTCCAGCGGGAAAAGCGAACGACGTTTTCCTCCGAGGAAGGAAAACCATTTCGGAGCTACGAGGACGATTTGGACAGATTTCCATGCGATTTCGAATGGGCCGAGGTCCCAGACCAGATCAGGTGGAGGCGGAAGGAGGCTGCAAGGTTTGCGTTCAGAAGGCAGAGTGAAGCGCGAAGATAGCGGAATCACGATTCCGTTGTGATTTTGTGGTGTAACGCGGTTGATTTCTCGCATTGCTGCCTCGTTGCGTAGCGCAGAGGGAGGGAAATTGGTTCCTTCGGGTTTTATCTGAGCAACGTAACAGGCTGTCTGTGAATGCGATCGATGTGATTGAGCCGGGTTGGGTCTTTACTTCGTGTGGGGCTGAGCTTCAACTGCGACTGCGATCTGGAGAAGGGGAGAATATTAGAAAATATTGTGTAGTTTGAGGGTCGCAGAGACGGAGAGCAAGCCGGAGGAGTAGTACATTGTATTTTCCTGTGCCTGATTGGCACATTTTAGGATGGGGCTTCTTTCAATTATCAGAAAGGTGAAGAGAAAAGAGAAAGAGATGCGCATTCTGATGGTGTATGTTCCTCCTCTCCGTGTCGATTCTCTTTTCGCAGGTGAAAATGACAGTTTCAGGTTGAAATTTTTTCCTACTCTTTCGCAAGATTGCGAAAGTTGGAAAACTCAATTCTTGAGTGTCGATGAATTGGCTTCCTGCTTCACCAATCTCTAAATATCCTTCCTACATGTTGGTCACAGAGGGCTAGACAACGCTGGAAAAACCACTATTGTGAAGAGAATAAATGGCGAGGATACCAGCGGCATCAGCCCTACCCTTGGATTCAATATCAAGACTATGCAATTCAAGAGGTACCAAATTGTCCGCCTGATTTTCGTCTTATTACATGAACCCTAACTATGGCCAGCTATAGCAGTACCTTTCTTAATATAAATGTCCATACACCTACCATGTTTTTGCGCTGGAAATTCGCTCTTGTGATTCTTCGTTTCTTACGAACCATGTTTCTCAAAATCAGTAGAGCGAATAAAATTTGAACTTTAGTTAGCTGACACCTTGGTCTTCGAACCTGTTCCATAACTTTCTTAGTTTGGAGGAGACTTCGAAGACCTGTGGGGTATCACTCAACCGGTAATTTCCAAAGGGTAAATTATCTTCTATGTTGGGCCTACAAGCCAGCACTTGTCAGATAAGATATATACGATCCTCATAACAAGCAGAGCAGAAGCAGTCTCTGAAAATTGAGGAGTGTTGAAACGTTTTGACTGTCCGTCAAAGTGTTTCACAAGATTTGGGTTTCTTTCAATGGAGGGTCAGTTTCGCCTTAAGGTGACTAAACTTGGTTGTTACTTTGGACAACTTCTGAAGGTAATGTTTTGTCCATCTGCACAGTTATCGTGTCAACATTTGGGATGTTGGAGGGCAGAAAACTCTTAGGTCGTACTGGAGGAACTATTATGAGCAGACAGATGGGATGGTCTGGGTTGTTGATAGTTCTGACATTCGGCGTCTACAAGACTGCCGAGAAGAGCTTCACGGCCTTCTTCAGGAAGAGGTATGACATTTCTTGAACATCATCTTTGTCCATTTGGCTTAAGTTGCCGATGTAAGTCTCATAAGCTTAAATTTTTGTGGGGAGTGAGAGTGACTTTTGTAAAGACTTTAGTGTTATTCTCTGTTTTATATCATTATACAAATCCCAACCAGAGAGTGGTGACTGCCGGAGTAAGCTTTCTGTCAGTAGGTTTTTATTCGATCCTCATGCATATTTTTAAAAACGGACGACGTTCATTTTTTGTTGCTTTCTTAGGAAGTGTGAGCACTGTGATCAAAGCTTCCCACGGTGTTTTAAGCAGAGAGGGTAACATCGTTTCGTGTGATTCTTCTTACAGAAACTAATGGGGGCCTCTCTCCTCATATTTGCGAACAAACAGGATTTGAAGGGATCATTGTCCCCTGAAGACATCGCTAAGGTGATCTCAAGCGTAATTACTTTCTAGTATTGCGAGGTGGTCATATTTAGATTCGGATATTCTGTCATTGTGGAATGCAAATAGTCATTGGCGTTCGATTGTTGAATCTTCTTTGTTTGATCCTCTTTCAAACTGGTCTGTTCTAACCGCTACATCTTTTACACGATCAAGTTGGGTGTCTTGTATTTAAAGAGCCGTATTCGTCTTTGCATTTGTGGCAGGTACTGGACCTCGGACTCATGGACAAAAGTAGGCATTGGCAGATCGTCGGTTGTAGTGCTGTTACAGGCAAGGGACTTCTGGATGGGTTCGATTGGTTGGTATCGGACATCGGTTCCAGAATTTACATGCTGGACTGAGAATGAAGTGTCCTGTCGAGCTTAAACTAGAACCGGAGCTCAAACTACCCTCCTTGGTGACGGTGTTACCCTGTTTGCAGTTACTGCACGGATGGAACCTAGTTGACCATTCAACGTCGTGTGGCTTGCTGCTCTTGTTTCCACATATGCTCACAAGGTTCTGGATGGCCCATACATTAGCTGTACCACCGTTCAGTCCACCGAGTAACTTTATCATTGTCGGTGCCTGAAGTGTCACGAACTTGACCAGCTGAGCACTAAAGCGTCTTGCACTGTTGTGTTTCATGGTGAATCCAAGAGGACGTCATTCGACATCAACTCATGTGAACTTGGATGTGCCAGGAGCTAGTGTGTAGTCTTACTTATCCAGTACTTTCGGGAACTGAAAGGGTCAGTTAAGCAAGGCTTTGTGCCGCGATTATTATATCCCTCTCGTTATGAACTCTGCGGGAATCGTGTTCACCTGAAGAGCTACTCAGTGGATTAATTATCACTGGTATTGATCAGTGATATTGAACTAGAAGTACAGTCCGACTCACTGGCTCTCGAGCCAGTGAGTTGTTCTGACGAAAGACTGAGCTCATGGTACTGTGATAGCTGGACAAAGTATACTTCGAGGCAGTCCAAGAGGAGTGTCTCATTGAAGTGGCCATGTTAGAGCCCTCATGATTGTAAAATATTGAGATGATTGTACACAAGTGATTCTATCAGTGAGTTCCGTTAAGCGTGACCACTATGCCTGGAGGAATGTTATACGTGTGCCACCATCTGAAGCAGACCTTCGTCTGGCTGATAGCAGGCGCTTGTATTCATTAGATGTGGACTTACTGTGCAAGAATAATGATCATCTCAAGTGTACTTCGGTGACCAATCATAGCGAGGAGAGTCGGCCAAGGTAGG

mRNA

>Mapoly0224s0005.1
TTTGTGACAAAGGCATCGCTCGGCCCTTAAACAAGGCGAAGAACTCCGTGACACAAAGAAGACTTTCGTCTTGGCTGCAGTACAGGCAACGCATTTAACTTGGAGACATGACTCTCGGAGACTCAGGGATGGGACTCGGGTTAACGACCTGGACAAGTAGAGCTTCTGTAGCCTGTTAGCGGATTCCAGCGGGAAAAGCGAACGACGTTTTCCTCCGAGGAAGGAAAACCATTTCGGAGCTACGAGGACGATTTGGACAGATTTCCATGCGATTTCGAATGGGCCGAGGTCCCAGACCAGATCAGGTGGAGGCGGAAGGAGGCTGCAAGGTTTGCGTTCAGAAGGCAGAGTGAAGCGCGAAGATAGCGGAATCACGATTCCGTTGTGATTTTGTGGTGTAACGCGGTTGATTTCTCGCATTGCTGCCTCGTTGCGTAGCGCAGAGGGAGGGAAATTGGTTCCTTCGGGTTTTATCTGAGCAACGTAACAGGCTGTCTGTGAATGCGATCGATGTGATTGAGCCGGGTTGGGTCTTTACTTCGTGTGGGGCTGAGCTTCAACTGCGACTGCGATCTGGAGAAGGGGAGAATATTAGAAAATATTGTGTAGTTTGAGGGTCGCAGAGACGGAGAGCAAGCCGGAGGAGTAGTACATTGTATTTTCCTGTGCCTGATTGGCACATTTTAGGATGGGGCTTCTTTCAATTATCAGAAAGGTGAAGAGAAAAGAGAAAGAGATGCGCATTCTGATGGTAGGGCTAGACAACGCTGGAAAAACCACTATTGTGAAGAGAATAAATGGCGAGGATACCAGCGGCATCAGCCCTACCCTTGGATTCAATATCAAGACTATGCAATTCAAGAGTTATCGTGTCAACATTTGGGATGTTGGAGGGCAGAAAACTCTTAGGTCGTACTGGAGGAACTATTATGAGCAGACAGATGGGATGGTCTGGGTTGTTGATAGTTCTGACATTCGGCGTCTACAAGACTGCCGAGAAGAGCTTCACGGCCTTCTTCAGGAAGAGAAACTAATGGGGGCCTCTCTCCTCATATTTGCGAACAAACAGGATTTGAAGGGATCATTGTCCCCTGAAGACATCGCTAAGGTACTGGACCTCGGACTCATGGACAAAAGTAGGCATTGGCAGATCGTCGGTTGTAGTGCTGTTACAGGCAAGGGACTTCTGGATGGGTTCGATTGGTTGGTATCGGACATCGGTTCCAGAATTTACATGCTGGACTGAGAATGAAGTGTCCTGTCGAGCTTAAACTAGAACCGGAGCTCAAACTACCCTCCTTGGTGACGGTGTTACCCTGTTTGCAGTTACTGCACGGATGGAACCTAGTTGACCATTCAACGTCGTGTGGCTTGCTGCTCTTGTTTCCACATATGCTCACAAGGTTCTGGATGGCCCATACATTAGCTGTACCACCGTTCAGTCCACCGAGTAACTTTATCATTGTCGGTGCCTGAAGTGTCACGAACTTGACCAGCTGAGCACTAAAGCGTCTTGCACTGTTGTGTTTCATGGTGAATCCAAGAGGACGTCATTCGACATCAACTCATGTGAACTTGGATGTGCCAGGAGCTAGTGTGTAGTCTTACTTATCCAGTACTTTCGGGAACTGAAAGGGTCAGTTAAGCAAGGCTTTGTGCCGCGATTATTATATCCCTCTCGTTATGAACTCTGCGGGAATCGTGTTCACCTGAAGAGCTACTCAGTGGATTAATTATCACTGGTATTGATCAGTGATATTGAACTAGAAGTACAGTCCGACTCACTGGCTCTCGAGCCAGTGAGTTGTTCTGACGAAAGACTGAGCTCATGGTACTGTGATAGCTGGACAAAGTATACTTCGAGGCAGTCCAAGAGGAGTGTCTCATTGAAGTGGCCATGTTAGAGCCCTCATGATTGTAAAATATTGAGATGATTGTACACAAGTGATTCTATCAGTGAGTTCCGTTAAGCGTGACCACTATGCCTGGAGGAATGTTATACGTGTGCCACCATCTGAAGCAGACCTTCGTCTGGCTGATAGCAGGCGCTTGTATTCATTAGATGTGGACTTACTGTGCAAGAATAATGATCATCTCAAGTGTACTTCGGTGACCAATCATAGCGAGGAGAGTCGGCCAAGGTAGG

CDS

>Mapoly0224s0005.1
ATGGGGCTTCTTTCAATTATCAGAAAGGTGAAGAGAAAAGAGAAAGAGATGCGCATTCTGATGGTAGGGCTAGACAACGCTGGAAAAACCACTATTGTGAAGAGAATAAATGGCGAGGATACCAGCGGCATCAGCCCTACCCTTGGATTCAATATCAAGACTATGCAATTCAAGAGTTATCGTGTCAACATTTGGGATGTTGGAGGGCAGAAAACTCTTAGGTCGTACTGGAGGAACTATTATGAGCAGACAGATGGGATGGTCTGGGTTGTTGATAGTTCTGACATTCGGCGTCTACAAGACTGCCGAGAAGAGCTTCACGGCCTTCTTCAGGAAGAGAAACTAATGGGGGCCTCTCTCCTCATATTTGCGAACAAACAGGATTTGAAGGGATCATTGTCCCCTGAAGACATCGCTAAGGTACTGGACCTCGGACTCATGGACAAAAGTAGGCATTGGCAGATCGTCGGTTGTAGTGCTGTTACAGGCAAGGGACTTCTGGATGGGTTCGATTGGTTGGTATCGGACATCGGTTCCAGAATTTACATGCTGGACTGA

Protein

>Mapoly0224s0005.1
MGLLSIIRKVKRKEKEMRILMVGLDNAGKTTIVKRINGEDTSGISPTLGFNIKTMQFKSYRVNIWDVGGQKTLRSYWRNYYEQTDGMVWVVDSSDIRRLQDCREELHGLLQEEKLMGASLLIFANKQDLKGSLSPEDIAKVLDLGLMDKSRHWQIVGCSAVTGKGLLDGFDWLVSDIGSRIYMLD

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>