Mapoly0240s0002



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PFAM PF13921 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp3R-MYB8 transcription factor, MYB Mapoly0240s0002.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0240s0002.1 scaffold_240:6206..9536  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0240s0002.1  

Gene structure:

mRNA scaffold_240:6206..9536  ( - strand )
three_prime_UTR scaffold_240:6206..6295  ( - strand )
CDS scaffold_240:6296..6599  ( - strand )
CDS scaffold_240:6707..6835  ( - strand )
CDS scaffold_240:7237..7340  ( - strand )
CDS scaffold_240:7437..7531  ( - strand )
CDS scaffold_240:7654..7711  ( - strand )
CDS scaffold_240:8196..8262  ( - strand )
CDS scaffold_240:8381..8517  ( - strand )
five_prime_UTR scaffold_240:8518..8536  ( - strand )
five_prime_UTR scaffold_240:8758..9536  ( - strand )

Sequences:

Gene

>Mapoly0240s0002.1
CACCTTACTGTTGATATAAATACGAAACATTGGAATATTCCTAATTCCTAGACCCTAGATCAAAAAATTTACTTATCTTCATAAAATTATTGATCACTTTACTTATCTTCATGAAAGGATTGATAATCGAACTGATTAACATCTTCACCTTCACTACTCCATTCGTTAGACAGAAAAGGATTGATGGAGCTTGATGTAAGGGTGAAGATGACAATTTTTTTACCAGATCCTGAAGTTAATCAGTCTTGTCCCCAGGTATAAGCTTACCTTGGTAGCTCAGACTTAGTGTGTTTGATGAATCTTGGAATATACTAAAATTCTAACTTTATCGTAGTTTCTTAAGAGGTAAGAGTTCTCGCAACAATACGATGAGGAGGTAAGTTTGACCTACCACTAGGAATTTTTTGATGCAATATCTAGTAGGTAGACTTCTGTCACAGGATTGACAAGATAGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATCCAAGTTCATGCATGATGAAAATCAAGCAGATCTTCCGATGGTTTCTGTTCTTCTCCTTTTCAGAAATAATAAATTTTAGTAATGATCATGAGAATTAGTAACCTTTCATTGTTTCAAGTGATTTCAATAGTAATAATTCATTCGTTAATGAGACAAGCGTAAATTATGTCCCTAATTTGGGAACTAGATAGCATGAAAAGAGACCATGAAATATCTTACCACCTGTATGTGTTGACTCCCAGATCCATCTGTAGATCGTCTAAGATCTGTGCATCAGATCCGAGCATAGGTGAGTGTACCGATGAAATAATATATTAACAATTGTAGGTTCTGGCCGAGTCATCGCAATCAAGCTCAATTATAAACTGCTTAATAGTCTAGGTCATACAATTAGATAGTTTTCTCTCTTATATTTCGCACCATCCGAATTGGCCATGTATGTCATCTACATTAATTTTGTGCTTCTTTTTTTCAGTTTAGTGAAACTAACAAAAACTGACTAAACTTCAGAGTTGTTTCCGATTCGAATATGGAGAAAATGGAGGGCTCCACATCTTCGACACTACCAAAGTTGCCACTCAGGAGATGCCTCGAAGACATCAGCAATTCTAGCGAGCCCAATCTGCCTTCTGCTGCAGTCGTGGATGTTACCCTCGGCACAAAAGGGTGATCACAATTTATTTTGCTCGCAATTACACTGCGTTTTGTAGTTGTCTCCATGTAGATCCAAATGACGCATGATCTCTGAAGCCGAATATTCTTGTCGGTTCTATGAATGAAACAGGAAGAAGCTGAGAGTTTATCATGCTCCACGACGAAGGAGGCCATACACGTCGTGGACGGAGGAAGAAGTGAGGACACCATTGGTTGATAACTGATACTGTTTTAGCCTCTATGTAGACGAATCAGTCTTAGGAATGTTAGAAACATCGACAGGCCCAATGTCGATTCTGTCACGATTTTGAAACCATGATGTTCACGACCTTCAGAGGAAGCACTCGAGTTCCTCCAAGGAGGAGTGATGATTTTGGTTCATATTGTTTAGATTGGACAGTACAACTTAAGTTTTAATACTGTGCTTAGATTAGCGAATACAACTTAAGGTAATTTTTTCGATTCATTATCAGGCTTAGTCACAGGATATATTTTCTCACTCCGATAGTTGACTTGCCCTGCAACATCTGTAGTATTTTTAAGTAGGGTCTGTTTCTCTGACCACTCGTATTCAATGTAACATTTGATGAACATCCACAGGTGTTCTGAACTGAATATCTGCAGTGACTGAGTTTTACAATTAATCTGAAGCCAAGGCGACTGTTTACTTCATTGTTACAGGACACAGCATTGCGAGCAGCAGTTGGAAAGTTCAAAGGAAGAAATTGGAAAAAAATTGGTGAGTACACATGTACGAGTTTTTTTTAGATGAGTTAATTATTTTGGTAACTTTCAACTGCTATGACCACAACTCTTCTGTGTAAAATCTCAAGATATGTAATGGACTGATGGCATGTGCAGCTGCGAATGTACCGAATCGGTCAGATAATCAGTGCCTTAACCGCTGGCAGAAGGTCCTTGATCCTGCCCTCGTCAAGGGATCCTGGACGAAAGATGTAAGTGCCTCTTATATAAATAGATTACAAGAGTGAGGTACCCAAGATCCCACGTTCAAGAAACGTGATGATTGATATAAGTTGCTTATTTCGCAGGAGGACGATAAGTTGCTCGAAATGGTCAACGAGTTCGGCACCAAGACATGGGCTGCCATCGCTAGGTCATTGCCGAGCAGAAATGGCAAGCAGTGTCGAGAGAGGTGCGTATCAAATATGTGGTGATTTTTATGTTCCGACACTTAATAATCTCACTATAGTCTCTGAAATCTCCTACTGATGGTAATCCTGCTAATCATGTGAATTTTGAGGTGCACCTGTGAGTTTATGTGAAATGTTATTATTCGTGTTCTTGTTCTTAAATCTTGTTGTTTCAGAAAAATGAGTCGTTCAAACAGTAGCTTGAGAGAAAGAGTACTTTAAATAACATGTTATTAGTTTTAATATCTCTTTGTTTTTCGGATAAACAGTATTGATGTGAAATAGTTCACCATGGATATTTCTGTAATTTCTAGGTTATTAATTTTAAATTTACTCCAAATCTGCGAACTAAAAGTTTCACAAAACATTATTCTAACCTGCTTGGTAATTTATTACTTTACAGATGGTGCAATAATCTTGATCCCCAGATCAAGAAGGAGCCGTGGAATGAAGAAGAAGACATGAAGTTGTTTTTGGCTCACAAGAGGTTCGGCAACAGCTGGTCAAAGATCGCAAAGCTAATTCCTGGCAGGTAAAGTCAATATATTCGGAAGATTTAATTTGTGTGGTTACCCTGTATTATAAATGTAACTTAGCAATTTCCTCATCTAATTCTTTTGCACACAATGAATTCCACAGGTCGGAAAATGGTATCAAGAACAGGTGGAACATAACAATCCAAAAACGTGCGGATGCACTCGAACAATCCAGTGAGAACTGGATCAATAGGAACACATTTGAGGATATGTTATCCATTATTGACGATGTGGCTCCAACAGAGCTTGATGTTTCTGAAGATCATCTGGCATTGAATGGCGAGGCCAATATCGATCTTCAAGACTCGAATGCTGCGAAAGACCTTAAAGCATGGAACTTAGAGTTTGATATGGATGTTGATGTAGATAACTTCTTAGACCTCCCAGACTTGAACCTCTCTCCTTGATATCAAATTGTTACAGCTAATGTGAAGATACCTTATTGCAAAAATATAATGCATATACTTCATTTTTAAAAATGATTAGCACTTGAATGG

mRNA

>Mapoly0240s0002.1
CACCTTACTGTTGATATAAATACGAAACATTGGAATATTCCTAATTCCTAGACCCTAGATCAAAAAATTTACTTATCTTCATAAAATTATTGATCACTTTACTTATCTTCATGAAAGGATTGATAATCGAACTGATTAACATCTTCACCTTCACTACTCCATTCGTTAGACAGAAAAGGATTGATGGAGCTTGATGTAAGGGTGAAGATGACAATTTTTTTACCAGATCCTGAAGTTAATCAGTCTTGTCCCCAGGTATAAGCTTACCTTGGTAGCTCAGACTTAGTGTGTTTGATGAATCTTGGAATATACTAAAATTCTAACTTTATCGTAGTTTCTTAAGAGGTAAGAGTTCTCGCAACAATACGATGAGGAGGTAAGTTTGACCTACCACTAGGAATTTTTTGATGCAATATCTAGTAGGTAGACTTCTGTCACAGGATTGACAAGATAGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATCCAAGTTCATGCATGATGAAAATCAAGCAGATCTTCCGATGGTTTCTGTTCTTCTCCTTTTCAGAAATAATAAATTTTAGTAATGATCATGAGAATTAGTAACCTTTCATTGTTTCAAGTGATTTCAATAGTAATAATTCATTCGTTAATGAGACAAGCGTAAATTATGTCCCTAATTTGGGAACTAGATAGCATGAAAAGAGACCATGAAATATCTTACCACCTGTATGTGTTGACTCCCAGATCCATCTGTAGATCGTCTAAGATCTGTGCATCAGATCCGAGCATAGAGTTGTTTCCGATTCGAATATGGAGAAAATGGAGGGCTCCACATCTTCGACACTACCAAAGTTGCCACTCAGGAGATGCCTCGAAGACATCAGCAATTCTAGCGAGCCCAATCTGCCTTCTGCTGCAGTCGTGGATGTTACCCTCGGCACAAAAGGGAAGAAGCTGAGAGTTTATCATGCTCCACGACGAAGGAGGCCATACACGTCGTGGACGGAGGAAGAAGACACAGCATTGCGAGCAGCAGTTGGAAAGTTCAAAGGAAGAAATTGGAAAAAAATTGCTGCGAATGTACCGAATCGGTCAGATAATCAGTGCCTTAACCGCTGGCAGAAGGTCCTTGATCCTGCCCTCGTCAAGGGATCCTGGACGAAAGATGAGGACGATAAGTTGCTCGAAATGGTCAACGAGTTCGGCACCAAGACATGGGCTGCCATCGCTAGGTCATTGCCGAGCAGAAATGGCAAGCAGTGTCGAGAGAGATGGTGCAATAATCTTGATCCCCAGATCAAGAAGGAGCCGTGGAATGAAGAAGAAGACATGAAGTTGTTTTTGGCTCACAAGAGGTTCGGCAACAGCTGGTCAAAGATCGCAAAGCTAATTCCTGGCAGGTCGGAAAATGGTATCAAGAACAGGTGGAACATAACAATCCAAAAACGTGCGGATGCACTCGAACAATCCAGTGAGAACTGGATCAATAGGAACACATTTGAGGATATGTTATCCATTATTGACGATGTGGCTCCAACAGAGCTTGATGTTTCTGAAGATCATCTGGCATTGAATGGCGAGGCCAATATCGATCTTCAAGACTCGAATGCTGCGAAAGACCTTAAAGCATGGAACTTAGAGTTTGATATGGATGTTGATGTAGATAACTTCTTAGACCTCCCAGACTTGAACCTCTCTCCTTGATATCAAATTGTTACAGCTAATGTGAAGATACCTTATTGCAAAAATATAATGCATATACTTCATTTTTAAAAATGATTAGCACTTGAATGG

CDS

>Mapoly0240s0002.1
ATGGAGAAAATGGAGGGCTCCACATCTTCGACACTACCAAAGTTGCCACTCAGGAGATGCCTCGAAGACATCAGCAATTCTAGCGAGCCCAATCTGCCTTCTGCTGCAGTCGTGGATGTTACCCTCGGCACAAAAGGGAAGAAGCTGAGAGTTTATCATGCTCCACGACGAAGGAGGCCATACACGTCGTGGACGGAGGAAGAAGACACAGCATTGCGAGCAGCAGTTGGAAAGTTCAAAGGAAGAAATTGGAAAAAAATTGCTGCGAATGTACCGAATCGGTCAGATAATCAGTGCCTTAACCGCTGGCAGAAGGTCCTTGATCCTGCCCTCGTCAAGGGATCCTGGACGAAAGATGAGGACGATAAGTTGCTCGAAATGGTCAACGAGTTCGGCACCAAGACATGGGCTGCCATCGCTAGGTCATTGCCGAGCAGAAATGGCAAGCAGTGTCGAGAGAGATGGTGCAATAATCTTGATCCCCAGATCAAGAAGGAGCCGTGGAATGAAGAAGAAGACATGAAGTTGTTTTTGGCTCACAAGAGGTTCGGCAACAGCTGGTCAAAGATCGCAAAGCTAATTCCTGGCAGGTCGGAAAATGGTATCAAGAACAGGTGGAACATAACAATCCAAAAACGTGCGGATGCACTCGAACAATCCAGTGAGAACTGGATCAATAGGAACACATTTGAGGATATGTTATCCATTATTGACGATGTGGCTCCAACAGAGCTTGATGTTTCTGAAGATCATCTGGCATTGAATGGCGAGGCCAATATCGATCTTCAAGACTCGAATGCTGCGAAAGACCTTAAAGCATGGAACTTAGAGTTTGATATGGATGTTGATGTAGATAACTTCTTAGACCTCCCAGACTTGAACCTCTCTCCTTGA

Protein

>Mapoly0240s0002.1
MEKMEGSTSSTLPKLPLRRCLEDISNSSEPNLPSAAVVDVTLGTKGKKLRVYHAPRRRRPYTSWTEEEDTALRAAVGKFKGRNWKKIAANVPNRSDNQCLNRWQKVLDPALVKGSWTKDEDDKLLEMVNEFGTKTWAAIARSLPSRNGKQCRERWCNNLDPQIKKEPWNEEEDMKLFLAHKRFGNSWSKIAKLIPGRSENGIKNRWNITIQKRADALEQSSENWINRNTFEDMLSIIDDVAPTELDVSEDHLALNGEANIDLQDSNAAKDLKAWNLEFDMDVDVDNFLDLPDLNLSP

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>