Mapoly0330s0001



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
KOG KOG0048 Transcription factor, Myb superfamily
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PFAM PF13921 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp3R-MYB9 transcription factor, MYB Mapoly0330s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0330s0001.1 scaffold_330:7530..14607  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0330s0001.2 scaffold_330:7530..14302  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0330s0001.1  

Gene structure:

mRNA scaffold_330:7530..14607  ( - strand )
three_prime_UTR scaffold_330:7530..7805  ( - strand )
CDS scaffold_330:7806..8130  ( - strand )
CDS scaffold_330:8248..8376  ( - strand )
CDS scaffold_330:8591..8694  ( - strand )
CDS scaffold_330:8798..8892  ( - strand )
CDS scaffold_330:9244..9301  ( - strand )
CDS scaffold_330:9759..9825  ( - strand )
CDS scaffold_330:9944..10065  ( - strand )
five_prime_UTR scaffold_330:10066..10093  ( - strand )
five_prime_UTR scaffold_330:10317..10363  ( - strand )
five_prime_UTR scaffold_330:14137..14607  ( - strand )

Sequences:

Gene

>Mapoly0330s0001.1
GATGTTTTCTTCCTGAAAGTGAAACTTTACCTCATTATCGAAGAAGAGATTCGGAGTTACAAGATCGGAAACTTTGTTTGAGATTGCGATGAAACTCTCGTATCACCAACGGTCAACGACATCGACGTTTGTTTGACGTTGCTTTTCTTCAAACGTTAGAATTACTCTCCGCGTCTCCGCGCCAGGCTCCTGCAGTTGGATGGGAGGTTACTTCGGAAATTTCAAATTTTTGTTTGAATTTCATCAGTTTCAACTTGGAACAGATAAGTCCTCCGTCTTACCTATCGTTTAGTTCAATGTGTTCAGTTCAGTTCACGAGACGATGGTCTAGACAGATTGCTTGAGTTTCCAACTTGTGACATACGTGATTCCTTAGCGATCATTCGCATAGTACTTTCTTGCCGTGCATTGTCTGCTGCCGAGCTACTGATCGAGTTGCTGTGAGAGACAGAGAGTTGTGATCTAGCTCAGGTTTGTTGACATTTCAATATTATCAACAAAATCTCAGTAAAATAGTATAATAGGAGGAGAGTAATAAATCTTTCGTTTTTTTCACTCGCAATTACTAATTGGATTCATGTTATGTGGTTACACACTAATGACATGATTTATCTCAGCTCAATGACCCTTTCGACGCTATATAAACATAAAGTTTGCACAGAAGATGTGAACAGTGTAAGTAGTTTGTGTTTAGAAGGATGATTCTTTTCCTGTGAACTTATTTGCCCAATTACAAATTGAATGGCTTCATTCCTAGATTAATGTACTACTTCAACGATAAAGTTTCATATTTAGTTTGATCCAAAGATTTCAAAAGGTAATTTTTCAATCGCTGCATTTCACTGTGTTTCCTCAGTCTTGCCATGGTGACATATATTGTGGTTTATGTAAGTACTTTGCATGGCCACGGTTGAGTTTGAAACTTATAAAACCTATCAAAAAATCTTGATCAGATTTGTGAAAGTACATGCAAGTATTCCCATAGTTGTGTTTGAAACTTACAAACTAACACAAAGATTAATTAGATTTGTGAAAGTACATGTAATTATTGCGATGGTTGTGTTTGAAACTTACAAACTAACAAAAAGATTGATTAGATTTGTGAAAGTAATTGTAAGTGTTGCCATAGTTGTGTTTGAAAGTAAAAAGCTATAAAAAAATTTGAGAAGACTCGTAACAGTAATTCTAAGTATTGTCATGGTTGCGTCGACAACGTAGAAACTGACAAAAAATCTTGTCACATCTCTGAAAGTACTTTTAATTATTGCCATGGTTGTGTTCGAAACCTACAAGCTATAAAACAATTTGATAAGATTTGTAAAAGTACTTGTAACTATCGTCATGGTTGTGTCTGAAAGGTTAAAACTATCAAAAATCTGGTCATCTTAGTATTGCTGTAATTCTTCATCTTGACTTTTTTCCATTGTTCAAATATCTTAATTGAATCAAAACAAACGATGCGATTTGTTCAACTATTCACGTCTTCTAGCTAATTTCAACCAACTTCAAGTAATTTACAAGATTCAAGCGATCATGTAAAAGTTATTTGTTGCTTCATACTGCCATATTGAGTTAGAAGACCTCTTAGGATCTCCTTAGTCCCTTTAAAGGGTCAAAAGAATCTCTTTTGAGATTCTTTCATACATACTCTACCGCCTTGACATAGCAAATTCATAGGAAACTATTCAACTTCTTCTTCTCCATATATGAAGTATATGAATGCAAACATCCAAGAAAAGTTTATATCTTTTATTTTCTATTATAGAAATCTAATTTCCAACTGATGAACAAAGATAATGAAACAAGTCTATTTATATGCTGTAGGAACTTCGTACGTTTGACCATCCTATTCACTATACCCATACAAGAAAAGTACTTATCCAACTCAAAAATCCATTTCAGGGATCATTCGATTTCATGACTAACATCCAAAATGTTGTCATATAACCTTCTGTAGCATTCGCTTTCTAAGAAAGCAGAAACCTCTTGGTTGAAGAAAACCCACATCGTCTCTCGTTCCATGTGAATTAGTATTTCATGCAGATAAGATTCTGAAATTTCGACAGATGGAGTGTTGATAAAAAATCCATTGTCACCAGATCTCACTATTTGAAGGATATTATTTTCAAAATAAGCCAAAAGAGATGATTCTAACTTAGAAAAGACACACATCAGAAAAGACTAAAGTCAATCTTTCCTGATTTTCAACCTTGTTTCTCTTAGGCAATCCTATACCAAAGAAGCCTCAATGAAACAATTTTTTTTCTTATAAAAATTGTACTAATTTTATCATGTAGAAACCAGTTTTTTGGATGTATTTTACAATTTATCGCTTGAATCCATTCCTCTACTTGATGTTTGATATGTTGTAAAATTAGATGGGTCCTTGTGGTTAGAATCTTCTGAGAAATTATTTTTTATTCGAAGGAAGGATTCTTGCTTATTGCTTCTATCATCCATTTGCTGGTGTTTAGCGAGATCATATATGAATAAGTTTATGGAATCTTCTACAGCCTTCTCAACACCTGAAGGAAACATTGAAAATAAGAGTTAAACTTGTTTACAACAACCTGTATCAGACTGTTTTGACACTACTTACATGCGTTGAGGTCAAGGTTTGTACACTTGACGACAAATAATAAAACTTGACCTTCAAATATAATGGTGCAGTTAAGCAGGTGAGGAGGTTTCCGACTTTTCATATCCTTCAATATCTTTATTTTTATGTGGTTTTTGGATATCATGTTTTCGAGGAAGTTCAAGCAAGATAACTTCTAGTTGATAATTGACAAGCTATGATTCAAACTACCAAGCTTTACTTATCACGCCATTTGGTGCTCATTAATTAGATCATACATATTTCTTGTGTGTACCAACTGCATAACAAAAAAATGCTTTTACTGAGAACTATATGTTCTCAAATTTGAAAATAGACCCATAGGAATTCTGATTCTATCAACTGAATCAAATTGGTACGTGTTTTTCTTCTCTTATCTCACATCATTCCAGACGATATGCTCCTTCCCATATCTTACTCCAATTATACGTTACACCACTCTACACGAACAATGATGATGATAAAGCCTCTCAATCATAAGATACTTAATCAAACTTTCCATACCCCTTACTTCTTGATGGTATGTTTTTAGAGATTCCCACCTTACTGTTGAATAATACCTCTCATATCTTGTTTAGATACTTAATCAAACTTTTCATACCTCTTACTTCTTGATGGTATCTTTTTGTCGAGATTCCCACCTTACTGTTGAATATTACGTCACATTGGAATATTCCTAGTTCCAGACCCTAGATGAAAAAGGTTACTTATCTTCATGAGATCAATTCTTTCATTCATATTCATAGAGTATATGTTGGTTTGCCCATTGTGATATTGCGCAAGAACTGTTGAAAATTTCTGGCTATTTCAAGATCGCTGTAGCAATCAAATTTGTCTAATATGACAAAGATTCCGACTAACGCATAGACGAGAGAAGAGCGATATTATGCTGTTGAACATCTCACTTCCTTGGATCAGTTCTTTTCACATCTTGCACGCTTATCTGACAAAGAGATGCACGAGAGATCAGTATACATTATCCTCTTTACCAAATTCTCTTGTTGATCACTTCGATAGGATCAGCATAAGATACATTTGTTACAGTTATCCATCTTTTTCCAGATGACACCAGATATGTTTTCCATGTGGGATATTTTTCTGTCTAAAGGATGGAATAGTTAGGGTAGAGATGCCAAATTTTTTACCAGATCCTGAAGTTGATAAATGTTGTCCATAGGTTTAAGATTTCTTTGGTAGCTTAGACTTAGGGTGTTTGATATATCTTGGATTCTAACTGTATCTAAGAGTTCTCGCCACAATGCCAGTAGGAGGTAAGTCTGACCTACCAACAGGAATTGCTTGATGCAATATCTAGTAGGAAGACTTCTGTCACAAGATTGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATATTTGTGGCAAGTTCATGAAATTCAGCCAGATCTTCTGATGATTTATGGTCTTTTCCTTTTCAGAAGTAACATATTGAAAAATGATCATGATAATCAGTAACCTATCACTGCTTTATGACGTTTCAATATTAATACTTCATCAGTTAACGAGACAAGCGTAAATTATGTCTTCGGGAAACCTTTTATTTTGAATTAGATAGCATGACAAGAGACAATGAAATATCTAACCACATGTATTTGTTGACTCCCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAGTGAGTGTAAGCATGAATAATACATTAATAGTTGTAGGGTCTGGCTGAATCATCGTAATCAATTTCAATCATAAACTCCTCAATAGTGCAGGTCATACAACCAGATATGTTTCTCTCTGATATTTCGCACCCTCGGAGTTGGACATGTATGTCATCTACATTAATTTTTGTGCTTCTAAGTTTCCAGTTTAGTGAAACTAACAACTTTATGACTAAACTTCAGAGTTCTTAACGATTCGAACTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTGCCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGTAAGCACAATTTATTTTGCTCGAAATTACACAGCGTTTTGTTGTTGTCTCCATGTAGATCCAAACGACGCATGGTCTCTGAAGCCGAATATTCTTGTAACTTCTATGAATGTAACAGGAAGAAGATTAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGTGAGTAAACCATTGTTTGATAACTAATACTGGTGTAGCCTCTATGTAGACAAATCAGTCTTAGGAAAGTTTGAAGACTCGACAAATTCAATGTGGATTCTGTCACGATTTTGAAGCCATGATGCTCATGACCTTCAGAAGAAGCACTCGAGTTCCTCCAAGCATGAGTGATGTTTTTGGTTCTATTTGTTGATTAATTATGCTTAGATTGGCGAATACAACTGAAGGTAAGTTTTTCAATTCATTATCAGGCTGTCACAGGATATATTTTCTCGCTCCGATATTTGACTTGCCCTGCACCATCTGTAGTATGCTTAAGTAGGGTCTGGTTCTCTGACCACTGTTATTCAATGTAACATCTGATTAACATCCACAGGTGTTCTGAAGTGGATATATGCAATGACTGAGTTTTACAACTAATCTGAATCCAAGGAGACTGTTAAATTTATTGCTACAGGACGAGACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGGTGAGTATCAGAAACCGTTGGGGCGTGTCCATCAAATTCAAATTTGAACTACCCGCTAGATGTGATACGCGTGTGCCCTTGTCATCGGGACTTGTACAAATTTTGGCGGGTGGTAAAGTCTGTAACAACTGCTGTCCGGAGTGACAGCGTAGTTACACAAAAGAGTTCCTCAAAGGAGTATTGATCTAGAGGCTGCAGTAGTGGATTGATCTCAGCATTAGCACGACGGCGCAGACGAAGAGAATTGAGTACGAGATGACGAAGAGAATTGAGACAGAGATCGCGCAAAAGGTGACCACAACTCTTCTTTGTAATATCTGAATTTATGTATTGGACTGATGGCATGTGCAGCTGCAAATTTACGGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGTAAGTGACTCTTATATAAGCACATATTAAATTACGAGAGTGAGGTATCCCAGATCCCACGTTCGACAAATGTGATGATTGATTTAAGTAGCTATTTTCGCAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGGTGGGTATGAAGTATGTGGCTGATTTATATGTTCCTAACTTAATACGATAGTCCCTGAAATATACTATTGATGGAAATGCTGCTAGCATGAGTGTTTTGAACTGCAACCGTGAGTGTATAGGAATTGTAAGGACTGAATTTGTGCTTTACTTCAAATGTGGAACTAAATTATTCACAAGAAATCTCTCCAACTTGCTCATTTATTGCTATGAAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCTTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCCAAGATTATTCCTGGCAGGTAAGTTCAGTATATTTGGAAAATTTATATTTTATGAGGCCAAGCTCTATTACAATTTTTCATTAGCAATTTTCTCATGTAATTCTTCTGATTGTATTACATTTACACAATTATCAGGTCGGACAATGCCATCAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTGTTCCTTTACTGAAGATGTGGCTCAAACAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTGTGACATGGAATGGCGAGTCCAATATCGACATCCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCCGATAAGATTGAGGATGAAGATTGCTTCCCAGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATAGGCGCTCGTGGCTTGTGCCTTGTGCGGTATGTAGTTCGGGGGTGTTTGGGTTTGAAGAAGCTCTGTGAGAGAACACTAAATTCTTATTATTTTCTTCGACTTGCTGTACATCAAAATTTTATAATTGAGATTATATAATCCTGGAAGGATTGCAATTCAATCAGTACAAGTTTCCACATAAATGTTCATAGATGTAGGTACTGTTCCACTAATGTAGTCTGTCATGA

mRNA

>Mapoly0330s0001.1
GATGTTTTCTTCCTGAAAGTGAAACTTTACCTCATTATCGAAGAAGAGATTCGGAGTTACAAGATCGGAAACTTTGTTTGAGATTGCGATGAAACTCTCGTATCACCAACGGTCAACGACATCGACGTTTGTTTGACGTTGCTTTTCTTCAAACGTTAGAATTACTCTCCGCGTCTCCGCGCCAGGCTCCTGCAGTTGGATGGGAGGTTACTTCGGAAATTTCAAATTTTTGTTTGAATTTCATCAGTTTCAACTTGGAACAGATAAGTCCTCCGTCTTACCTATCGTTTAGTTCAATGTGTTCAGTTCAGTTCACGAGACGATGGTCTAGACAGATTGCTTGAGTTTCCAACTTGTGACATACGTGATTCCTTAGCGATCATTCGCATAGTACTTTCTTGCCGTGCATTGTCTGCTGCCGAGCTACTGATCGAGTTGCTGTGAGAGACAGAGAGTTGTGATCTAGCTCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAAGTTCTTAACGATTCGAACTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTGCCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATTAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAGACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCAAATTTACGGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCTTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCCAAGATTATTCCTGGCAGGTCGGACAATGCCATCAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTGTTCCTTTACTGAAGATGTGGCTCAAACAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTGTGACATGGAATGGCGAGTCCAATATCGACATCCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCCGATAAGATTGAGGATGAAGATTGCTTCCCAGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATAGGCGCTCGTGGCTTGTGCCTTGTGCGGTATGTAGTTCGGGGGTGTTTGGGTTTGAAGAAGCTCTGTGAGAGAACACTAAATTCTTATTATTTTCTTCGACTTGCTGTACATCAAAATTTTATAATTGAGATTATATAATCCTGGAAGGATTGCAATTCAATCAGTACAAGTTTCCACATAAATGTTCATAGATGTAGGTACTGTTCCACTAATGTAGTCTGTCATGA

CDS

>Mapoly0330s0001.1
ATGGAGGGTTCTTCGACACTACCAAAGTTGCCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATTAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAGACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCAAATTTACGGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCTTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCCAAGATTATTCCTGGCAGGTCGGACAATGCCATCAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTGTTCCTTTACTGAAGATGTGGCTCAAACAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTGTGACATGGAATGGCGAGTCCAATATCGACATCCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCCGATAAGATTGAGGATGAAGATTGCTTCCCAGACTTTGATTTTTGTCTTTAA

Protein

>Mapoly0330s0001.1
MEGSSTLPKLPQRRCLEEIINSSEDNLPSAAVVDFPLDRKGKKIRVYHAPQPRKPSTSWTAEEDETLRAAVEKFKGRNWKQIAANLRNRSDAQCLHRWQKVLNPILVKGYWSKEEDDKMLELVKTFGTKRWAAIARAMPGRNSKQCRERWCNHLDPKIKKEPWSEEEDMMLVMAHQRLGNRWAEIAKIIPGRSDNAIKNRWNTAKNKRSDALEQSSENWINSSTFGDMCSFTEDVAQTDLDANQHVLAWNGEPNVVTWNGESNIDIQDSNAAEDLALNSVFGPDKIEDEDCFPDFDFCL

Mapoly0330s0001.2  

Gene structure:

mRNA scaffold_330:7530..14302  ( - strand )
three_prime_UTR scaffold_330:7530..7805  ( - strand )
CDS scaffold_330:7806..8130  ( - strand )
CDS scaffold_330:8248..8376  ( - strand )
CDS scaffold_330:8591..8694  ( - strand )
CDS scaffold_330:8798..8892  ( - strand )
CDS scaffold_330:9244..9301  ( - strand )
CDS scaffold_330:9759..9825  ( - strand )
CDS scaffold_330:9944..10065  ( - strand )
five_prime_UTR scaffold_330:10066..10093  ( - strand )
five_prime_UTR scaffold_330:10317..10363  ( - strand )
five_prime_UTR scaffold_330:13933..13990  ( - strand )
five_prime_UTR scaffold_330:14137..14302  ( - strand )

Sequences:

Gene

>Mapoly0330s0001.2
GTTCAGTTCACGAGACGATGGTCTAGACAGATTGCTTGAGTTTCCAACTTGTGACATACGTGATTCCTTAGCGATCATTCGCATAGTACTTTCTTGCCGTGCATTGTCTGCTGCCGAGCTACTGATCGAGTTGCTGTGAGAGACAGAGAGTTGTGATCTAGCTCAGGTTTGTTGACATTTCAATATTATCAACAAAATCTCAGTAAAATAGTATAATAGGAGGAGAGTAATAAATCTTTCGTTTTTTTCACTCGCAATTACTAATTGGATTCATGTTATGTGGTTACACACTAATGACATGATTTATCTCAGCTCAATGACCCTTTCGACGCTATATAAACATAAAGTTTGCACAGAAGATGTGAACAGTGTAAGTAGTTTGTGTTTAGAAGGATGATTCTTTTCCTGTGAACTTATTTGCCCAATTACAAATTGAATGGCTTCATTCCTAGATTAATGTACTACTTCAACGATAAAGTTTCATATTTAGTTTGATCCAAAGATTTCAAAAGGTAATTTTTCAATCGCTGCATTTCACTGTGTTTCCTCAGTCTTGCCATGGTGACATATATTGTGGTTTATGTAAGTACTTTGCATGGCCACGGTTGAGTTTGAAACTTATAAAACCTATCAAAAAATCTTGATCAGATTTGTGAAAGTACATGCAAGTATTCCCATAGTTGTGTTTGAAACTTACAAACTAACACAAAGATTAATTAGATTTGTGAAAGTACATGTAATTATTGCGATGGTTGTGTTTGAAACTTACAAACTAACAAAAAGATTGATTAGATTTGTGAAAGTAATTGTAAGTGTTGCCATAGTTGTGTTTGAAAGTAAAAAGCTATAAAAAAATTTGAGAAGACTCGTAACAGTAATTCTAAGTATTGTCATGGTTGCGTCGACAACGTAGAAACTGACAAAAAATCTTGTCACATCTCTGAAAGTACTTTTAATTATTGCCATGGTTGTGTTCGAAACCTACAAGCTATAAAACAATTTGATAAGATTTGTAAAAGTACTTGTAACTATCGTCATGGTTGTGTCTGAAAGGTTAAAACTATCAAAAATCTGGTCATCTTAGTATTGCTGTAATTCTTCATCTTGACTTTTTTCCATTGTTCAAATATCTTAATTGAATCAAAACAAACGATGCGATTTGTTCAACTATTCACGTCTTCTAGCTAATTTCAACCAACTTCAAGTAATTTACAAGATTCAAGCGATCATGTAAAAGTTATTTGTTGCTTCATACTGCCATATTGAGTTAGAAGACCTCTTAGGATCTCCTTAGTCCCTTTAAAGGGTCAAAAGAATCTCTTTTGAGATTCTTTCATACATACTCTACCGCCTTGACATAGCAAATTCATAGGAAACTATTCAACTTCTTCTTCTCCATATATGAAGTATATGAATGCAAACATCCAAGAAAAGTTTATATCTTTTATTTTCTATTATAGAAATCTAATTTCCAACTGATGAACAAAGATAATGAAACAAGTCTATTTATATGCTGTAGGAACTTCGTACGTTTGACCATCCTATTCACTATACCCATACAAGAAAAGTACTTATCCAACTCAAAAATCCATTTCAGGGATCATTCGATTTCATGACTAACATCCAAAATGTTGTCATATAACCTTCTGTAGCATTCGCTTTCTAAGAAAGCAGAAACCTCTTGGTTGAAGAAAACCCACATCGTCTCTCGTTCCATGTGAATTAGTATTTCATGCAGATAAGATTCTGAAATTTCGACAGATGGAGTGTTGATAAAAAATCCATTGTCACCAGATCTCACTATTTGAAGGATATTATTTTCAAAATAAGCCAAAAGAGATGATTCTAACTTAGAAAAGACACACATCAGAAAAGACTAAAGTCAATCTTTCCTGATTTTCAACCTTGTTTCTCTTAGGCAATCCTATACCAAAGAAGCCTCAATGAAACAATTTTTTTTCTTATAAAAATTGTACTAATTTTATCATGTAGAAACCAGTTTTTTGGATGTATTTTACAATTTATCGCTTGAATCCATTCCTCTACTTGATGTTTGATATGTTGTAAAATTAGATGGGTCCTTGTGGTTAGAATCTTCTGAGAAATTATTTTTTATTCGAAGGAAGGATTCTTGCTTATTGCTTCTATCATCCATTTGCTGGTGTTTAGCGAGATCATATATGAATAAGTTTATGGAATCTTCTACAGCCTTCTCAACACCTGAAGGAAACATTGAAAATAAGAGTTAAACTTGTTTACAACAACCTGTATCAGACTGTTTTGACACTACTTACATGCGTTGAGGTCAAGGTTTGTACACTTGACGACAAATAATAAAACTTGACCTTCAAATATAATGGTGCAGTTAAGCAGGTGAGGAGGTTTCCGACTTTTCATATCCTTCAATATCTTTATTTTTATGTGGTTTTTGGATATCATGTTTTCGAGGAAGTTCAAGCAAGATAACTTCTAGTTGATAATTGACAAGCTATGATTCAAACTACCAAGCTTTACTTATCACGCCATTTGGTGCTCATTAATTAGATCATACATATTTCTTGTGTGTACCAACTGCATAACAAAAAAATGCTTTTACTGAGAACTATATGTTCTCAAATTTGAAAATAGACCCATAGGAATTCTGATTCTATCAACTGAATCAAATTGGTACGTGTTTTTCTTCTCTTATCTCACATCATTCCAGACGATATGCTCCTTCCCATATCTTACTCCAATTATACGTTACACCACTCTACACGAACAATGATGATGATAAAGCCTCTCAATCATAAGATACTTAATCAAACTTTCCATACCCCTTACTTCTTGATGGTATGTTTTTAGAGATTCCCACCTTACTGTTGAATAATACCTCTCATATCTTGTTTAGATACTTAATCAAACTTTTCATACCTCTTACTTCTTGATGGTATCTTTTTGTCGAGATTCCCACCTTACTGTTGAATATTACGTCACATTGGAATATTCCTAGTTCCAGACCCTAGATGAAAAAGGTTACTTATCTTCATGAGATCAATTCTTTCATTCATATTCATAGAGTATATGTTGGTTTGCCCATTGTGATATTGCGCAAGAACTGTTGAAAATTTCTGGCTATTTCAAGATCGCTGTAGCAATCAAATTTGTCTAATATGACAAAGATTCCGACTAACGCATAGACGAGAGAAGAGCGATATTATGCTGTTGAACATCTCACTTCCTTGGATCAGTTCTTTTCACATCTTGCACGCTTATCTGACAAAGAGATGCACGAGAGATCAGTATACATTATCCTCTTTACCAAATTCTCTTGTTGATCACTTCGATAGGATCAGCATAAGATACATTTGTTACAGTTATCCATCTTTTTCCAGATGACACCAGATATGTTTTCCATGTGGGATATTTTTCTGTCTAAAGGATGGAATAGTTAGGGTAGAGATGCCAAATTTTTTACCAGATCCTGAAGTTGATAAATGTTGTCCATAGGTTTAAGATTTCTTTGGTAGCTTAGACTTAGGGTGTTTGATATATCTTGGATTCTAACTGTATCTAAGAGTTCTCGCCACAATGCCAGTAGGAGGTAAGTCTGACCTACCAACAGGAATTGCTTGATGCAATATCTAGTAGGAAGACTTCTGTCACAAGATTGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATATTTGTGGCAAGTTCATGAAATTCAGCCAGATCTTCTGATGATTTATGGTCTTTTCCTTTTCAGAAGTAACATATTGAAAAATGATCATGATAATCAGTAACCTATCACTGCTTTATGACGTTTCAATATTAATACTTCATCAGTTAACGAGACAAGCGTAAATTATGTCTTCGGGAAACCTTTTATTTTGAATTAGATAGCATGACAAGAGACAATGAAATATCTAACCACATGTATTTGTTGACTCCCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAGTGAGTGTAAGCATGAATAATACATTAATAGTTGTAGGGTCTGGCTGAATCATCGTAATCAATTTCAATCATAAACTCCTCAATAGTGCAGGTCATACAACCAGATATGTTTCTCTCTGATATTTCGCACCCTCGGAGTTGGACATGTATGTCATCTACATTAATTTTTGTGCTTCTAAGTTTCCAGTTTAGTGAAACTAACAACTTTATGACTAAACTTCAGAGTTCTTAACGATTCGAACTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTGCCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGTAAGCACAATTTATTTTGCTCGAAATTACACAGCGTTTTGTTGTTGTCTCCATGTAGATCCAAACGACGCATGGTCTCTGAAGCCGAATATTCTTGTAACTTCTATGAATGTAACAGGAAGAAGATTAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGTGAGTAAACCATTGTTTGATAACTAATACTGGTGTAGCCTCTATGTAGACAAATCAGTCTTAGGAAAGTTTGAAGACTCGACAAATTCAATGTGGATTCTGTCACGATTTTGAAGCCATGATGCTCATGACCTTCAGAAGAAGCACTCGAGTTCCTCCAAGCATGAGTGATGTTTTTGGTTCTATTTGTTGATTAATTATGCTTAGATTGGCGAATACAACTGAAGGTAAGTTTTTCAATTCATTATCAGGCTGTCACAGGATATATTTTCTCGCTCCGATATTTGACTTGCCCTGCACCATCTGTAGTATGCTTAAGTAGGGTCTGGTTCTCTGACCACTGTTATTCAATGTAACATCTGATTAACATCCACAGGTGTTCTGAAGTGGATATATGCAATGACTGAGTTTTACAACTAATCTGAATCCAAGGAGACTGTTAAATTTATTGCTACAGGACGAGACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGGTGAGTATCAGAAACCGTTGGGGCGTGTCCATCAAATTCAAATTTGAACTACCCGCTAGATGTGATACGCGTGTGCCCTTGTCATCGGGACTTGTACAAATTTTGGCGGGTGGTAAAGTCTGTAACAACTGCTGTCCGGAGTGACAGCGTAGTTACACAAAAGAGTTCCTCAAAGGAGTATTGATCTAGAGGCTGCAGTAGTGGATTGATCTCAGCATTAGCACGACGGCGCAGACGAAGAGAATTGAGTACGAGATGACGAAGAGAATTGAGACAGAGATCGCGCAAAAGGTGACCACAACTCTTCTTTGTAATATCTGAATTTATGTATTGGACTGATGGCATGTGCAGCTGCAAATTTACGGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGTAAGTGACTCTTATATAAGCACATATTAAATTACGAGAGTGAGGTATCCCAGATCCCACGTTCGACAAATGTGATGATTGATTTAAGTAGCTATTTTCGCAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGGTGGGTATGAAGTATGTGGCTGATTTATATGTTCCTAACTTAATACGATAGTCCCTGAAATATACTATTGATGGAAATGCTGCTAGCATGAGTGTTTTGAACTGCAACCGTGAGTGTATAGGAATTGTAAGGACTGAATTTGTGCTTTACTTCAAATGTGGAACTAAATTATTCACAAGAAATCTCTCCAACTTGCTCATTTATTGCTATGAAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCTTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCCAAGATTATTCCTGGCAGGTAAGTTCAGTATATTTGGAAAATTTATATTTTATGAGGCCAAGCTCTATTACAATTTTTCATTAGCAATTTTCTCATGTAATTCTTCTGATTGTATTACATTTACACAATTATCAGGTCGGACAATGCCATCAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTGTTCCTTTACTGAAGATGTGGCTCAAACAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTGTGACATGGAATGGCGAGTCCAATATCGACATCCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCCGATAAGATTGAGGATGAAGATTGCTTCCCAGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATAGGCGCTCGTGGCTTGTGCCTTGTGCGGTATGTAGTTCGGGGGTGTTTGGGTTTGAAGAAGCTCTGTGAGAGAACACTAAATTCTTATTATTTTCTTCGACTTGCTGTACATCAAAATTTTATAATTGAGATTATATAATCCTGGAAGGATTGCAATTCAATCAGTACAAGTTTCCACATAAATGTTCATAGATGTAGGTACTGTTCCACTAATGTAGTCTGTCATGA

mRNA

>Mapoly0330s0001.2
GTTCAGTTCACGAGACGATGGTCTAGACAGATTGCTTGAGTTTCCAACTTGTGACATACGTGATTCCTTAGCGATCATTCGCATAGTACTTTCTTGCCGTGCATTGTCTGCTGCCGAGCTACTGATCGAGTTGCTGTGAGAGACAGAGAGTTGTGATCTAGCTCAGCTCAATGACCCTTTCGACGCTATATAAACATAAAGTTTGCACAGAAGATGTGAACAGTATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAAGTTCTTAACGATTCGAACTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTGCCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATTAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAGACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCAAATTTACGGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCTTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCCAAGATTATTCCTGGCAGGTCGGACAATGCCATCAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTGTTCCTTTACTGAAGATGTGGCTCAAACAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTGTGACATGGAATGGCGAGTCCAATATCGACATCCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCCGATAAGATTGAGGATGAAGATTGCTTCCCAGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATAGGCGCTCGTGGCTTGTGCCTTGTGCGGTATGTAGTTCGGGGGTGTTTGGGTTTGAAGAAGCTCTGTGAGAGAACACTAAATTCTTATTATTTTCTTCGACTTGCTGTACATCAAAATTTTATAATTGAGATTATATAATCCTGGAAGGATTGCAATTCAATCAGTACAAGTTTCCACATAAATGTTCATAGATGTAGGTACTGTTCCACTAATGTAGTCTGTCATGA

CDS

>Mapoly0330s0001.2
ATGGAGGGTTCTTCGACACTACCAAAGTTGCCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATTAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAGACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCAAATTTACGGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCTTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCCAAGATTATTCCTGGCAGGTCGGACAATGCCATCAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTGTTCCTTTACTGAAGATGTGGCTCAAACAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTGTGACATGGAATGGCGAGTCCAATATCGACATCCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCCGATAAGATTGAGGATGAAGATTGCTTCCCAGACTTTGATTTTTGTCTTTAA

Protein

>Mapoly0330s0001.2
MEGSSTLPKLPQRRCLEEIINSSEDNLPSAAVVDFPLDRKGKKIRVYHAPQPRKPSTSWTAEEDETLRAAVEKFKGRNWKQIAANLRNRSDAQCLHRWQKVLNPILVKGYWSKEEDDKMLELVKTFGTKRWAAIARAMPGRNSKQCRERWCNHLDPKIKKEPWSEEEDMMLVMAHQRLGNRWAEIAKIIPGRSDNAIKNRWNTAKNKRSDALEQSSENWINSSTFGDMCSFTEDVAQTDLDANQHVLAWNGEPNVVTWNGESNIDIQDSNAAEDLALNSVFGPDKIEDEDCFPDFDFCL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>