Mapoly0502s0001



Description

Helix-loop-helix DNA-binding domain

Reference DB

Database ID Description
GO GO:0046983 Protein dimerization activity
PFAM PF00010 Helix-loop-helix DNA-binding domain
PANTHER PTHR16223 FAMILY NOT NAMED
PANTHER PTHR16223:SF15

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH43 transcription factor, bHLH Mapoly0502s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0502s0001.1 scaffold_502:2..4716  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0502s0001.2 scaffold_502:2..4716  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0502s0001.1  

Gene structure:

mRNA scaffold_502:2..4716  ( - strand )
CDS scaffold_502:2..97  ( - strand )
CDS scaffold_502:1889..1954  ( - strand )
CDS scaffold_502:2144..2323  ( - strand )
CDS scaffold_502:2499..2597  ( - strand )
CDS scaffold_502:2958..3229  ( - strand )
CDS scaffold_502:3415..4396  ( - strand )
five_prime_UTR scaffold_502:4397..4716  ( - strand )

Sequences:

Gene

>Mapoly0502s0001.1
ATCCTTCAGGGGGGCATCTGCCTTGCCTTCCTTCTCACTTGACGCTGCCCCCCTCGGCCCACTGACTGCTTCTTGTTCCCCCCTCGGGCCTCGGTTGCCTTGCCTGCGAATGTGCCTGCCTTCCTTCCGTCCGTCCAAAATCCCCCCCCAAGCCCCTTGAGAGAGACTGAGACTCAGACTCTGAGGGAGAGAGAGAGAGAGTGGTGAGAGAGTGAGTGAGAGAAAGAGAAAGAGAAGTGAGAGAGAGAGAGAGAGAGAGAAAGAAGGAAGAGAGGAGAGATGCCTCCCCCGGATCACTCAGGCGCAGCAGGGTCCCGTTCATGGCAGCGCAGCAGGGAGTCGTCGTAGGAGTCTCATCGTCGTTGTCGTCGGCGCATCGCTTGTTGCTCGGAGGAGGCCCAGGAGGCCCATCGTCGCCCGGTCCGACGCAGAGCCCGTCCTCCTCCTGCTGCCCCACCTCGTGCTCGCCCAGCCTCCAGGCGTCGGCCAGGACACTGCTGGGCTGCTCCTTGCCCCCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGGGATCAGCAGCCTTGGCCTCCGCGGCTGCGCTGGTGGTATCGACCCAGACTTGCTCTAGTAGCCAGGCCCAGCAGTATCAGTATCAGCAGCGTCGCTGCAATCCTGCGGCTGCGGCCTTCCATCATCATCAGCTGCAGCAGCAGCAGGCCCAGCCCCCATTCTTGAGCCCTCCTGCTCTTCAAGCGTTGCTGCCGAGCGGAGCGCACTCTGAGATGCAACCGGCTTCCATGCTGGGCTCGCGTGGCCCGGTGCCCGGCGTCAGCAGCGCTCGCTCCTCGCTTAGCAATGCGGCGCTCGCCATGCCTTCTCTCCTGAGCCCCCCTCACCAACAGCCCGCGCTGCAATTCGAGCAGGCGGAGCAGACTCCCCCCATGGATGAATTTCTCGAGCAAATGTTCTCGCTCCCGTCCTGGTCCGAAATGGCGGGCGCCGGCCGCGCCCCCTGGGAATTCAATGCTGCGGCCGCCGGCGCTGCCACGCGCCTGGGCGTCGACGCCCAGAAGCTCTTCACCATGTCGTTGCTGCCCCCCGGATTGCTGGGCGGCCCGCACACCTCCACCACCACCACCAACAACAACAACACCAACAACAACAATGCCACCAGCAACAACAACAACAACCACAGCGGCCGCGATTTGCAAGACGGAGCCGATTCCGCCCACGTCGGCGATTCGGTCCTCGGCTATTCCAACGACGATCACCTGCTCGGTGCTCGCCTGCGCGGCCTGCAAGAAACTCCCTCATCCGTTCCAGGTACACGCAATTTCCCTCCCCCGCATTCTGATTCGCCCCGGCGGGCCTCCCATTGGGATTCAATGCCGATCACCGCGCCAGCCATCGGAATCGACGCAATTCCCTCGTGTGTCGTGTGCTTTTGACAATGCCGCAGGTGCTGTGCTGTACTAACCGCTCAATTCGATTCGATCAATTCTCTCCAGGTATCGGAACTCGAGCAGGAGCGACTCTGACCAGGTCCCCGTCCGTAGGAAGCAGCGGAAGCGAAGGATCAGGTGGACCCCAATCGCCTCCTCCCATTGCCCCGACATGGAGGCAGCCATACGTAGGTGGCGTCCCACCTTTGCCATTGGGTTTAGGACAAGCAAAACCAGAAACGCTTCTTCGTGGTGACTCCGGAGAAGCGCATCTTCTTGGGAAAAGGCCTCGTGATGAGGACGAGGTCTCCATGAGAGAGGCTCATACAGGGAACAATGTGAGTCCGTGTTGCAGGCGAATTGCACTTGCTTCCATTGCTTCGAGCTCCGTAGGGCTTGAGAGAGACATAGACATAGACATTGAGAGAGAGCTTCGTATCTAGACGACGAGAGTGGGAGAGAGAGAGAGATTAAAGAGTGACTCTCGTCGTCTCGCAACCCTCTCTCCCTCATCATCATCGTCACCGTCATCATGCTGCTGCTGCTGCTGGCTCTCTAGAGTTTTCAGTGAACGATTTGAGTCTCTTCTCGTCTCGGTGATAGTGAATTTGGTCAAGGTGTTCGTCGCGAATTGGACGAGCGAGCACCGCTTTCTAGTCTCTTAACATTGAGGGCAACCTGTCTGATCGTCGTCGCAGGTTCGCGATGCACCGCAAGGACTTTTCGCCTCCTTCACCGGTGGCCAAGTGACCCAGAACCAAGTGCCTCGCTCAGCTGGGCAACAGTCCCATCAGCAGGTTGGCAAGCTCGACAGCCTCGTGTTGCTTTGAATGGATGATTGAATGAGTTAAAGAGACTGAGCTCCGCCGAGAGCATGATGGTATTGCGGAAGGGTTTGCAGCGAGGCGACACGAAGGGCACGAATCGAATGTGAGCTGAAATTGTGTTGTGCTGTGGCTCGCTACCTCGCAGGGAAATGGTGCCTCGTCTCAAGGGGTGCAAGGACAAGGACAAGCGCTGCCCACGTACGGGAGCCCCTCGATAACGGCGACGACGCAACCCCATTCGAATTCGGGTGTGGCCGTGGCAGCTCGACCTCGAGTCCGAGCGCGACGTGGCCAAGCCACCGATCCGCACAGCATTGCCGAGAGGGTGAGCTTTCCCGCGCTCTTCGCAATGTGACCAACCAATCAATCGTCCATCGCAGTCTAAACTTGGGCTCTCGCTCGCAAGTCCCGGCTGGATTTTCGAGGGCTCTCGAGATTGTTGCGCCCACAATGTGCCTGCCTGCCTGCCTGCGTCTCACGTGCGTGGCTCGTTTTGCTCTTGTGTGCCCTCCAGCTCCGAAGAGAAAGGATAGCGGAGAGAATGAAGGCATTGCAGGAGCTCGTGCCCAATTCAAACAAGGTGAGATTCTCCCTTTCCCTCTCTTTTCTTTCTCGTCCGCGTGCCGTGGCGCGACCTGACCCTCCTCGACCTCGTCCTCGTCCTCTTCTTCTTGAACCCCCATGATCAGATCAGCGTCCGTTGCTCTAGGGCCGTGTGATGATAGCTCGTAGAACTGGCGGACGTCATCATCATTCATGCCACTAATGCGCAAGTCCCCTCACAGAACCAAGATCGCTCGGACTCGATTCGGACTCGGAACTCGGAACATTGGAACTAAGCTCCAGACGACCGAATTTCTCTGACGGGATTGATCAGTCGCTCTCTCGTGAGGCTCGAGCCATGAGAGAAACAATTGGCGAGATTTGCGCAATTGATTGCCAGCAGCGAAAGATTGAGCCGAGCAGCAGGCGGGGGAAGAATGCAGTAGACTAGATGCGGTATCATTCGGTTGGACTGTCACAGGGATGTTCGCCCCCACCGACCCGACCGAGCGACCGAGGCAGCGAGACGAGCATAGGTCCAATATCTTTCACGATGTCTCGTGGCTCGTGGACTTGTGCCCATCGTTCTTTACAGTTGTCAGCCTACTGCTACTGCGCTTTGAGACCGAACGGTGGGTCGGGGGGCTGGGGCTGGGGCTGGGGTTAGGAAGAAGGCAGCGGGGCTTCGGTACGGCAGGTAAGCCCCGAGGCGGAGAATCTTCGACATACATTGAAGCGGGGCAGTATTCACGCAGGAAGCAGCGGCGGTCGCCTCATTGCTCGAGGCCATATCATTCTCGTAGCTCGCTTTCGGCGCAGCTGTGCGTGAGCCCAATCCGCTCGACCGGCCAATGGCTCACGTCCCGAGCTGCCTACTCTCCTCGACCTGGCCTGTCGAGACGGATCCAATGCGGCTACGACTCGTAGCCCAGCCACCCCTTCCCTTGCCGGGGGTGGGGAATGCGCTGCAGGGGGCTTGAGAAGCTTGCCGGCTGCGGAGTCGGACGGATCTCTCGCTTCCCTCCGAGGGAGAGAGGCGAAGGCGAGCCTCTTTTCCCCGTCGCTGAGCTTCCATAATTGGTCCCCAAGTCGGAGATGACACTCGCTCAGCGAGCACGATTTCTGCACTGCGGGACGTGCTCTGAGTCGATGATCAGATTCGGTTTCGTGAGAACGCTCAGATCAGCTCCGAGCGTGTAATCACTTCGAGCCCGTGATCGCAGATCCGGTGCTCCGGATGTGTGCATGTGCAGATCAATGTGCCTCTTTGGCCTGCTGCCGAATCGTGGACCTCGCTCGTTCTCATTCGATCCGCCCGCGAAGATAGATGAGTGATGAGTGGAGTTTCCTGCTGGCCCCGAAATCTTCCACCGCGCGAGGAGACGTGCAACAATTCTCGCACTGGTGAGTACGGCGCTTCGGCCGCGTACTTGCTCGTGCTCGCATCGTACCACATTTACGTTATGGACCTGTGGGATTCACCTGAGATCATCGAGCGCTTAATTGCCGCTCAGTACAGCGTCGAATAGCACTGGCACCGCGAGGAGTAAATTCCCGTTCGTCGTCACGTGAGCTGCTTTGCTGAAGCATCGGCTCTTATGAGCCCATGGCAATCTGATAGGACGCAGAAAGCCGTGAGCTGCATCTGAAATCATGCTCATCCGGAGCCGTCTGTGTGTCTGGTGCTCGACGGTACATTTTGGTCGAGGCTGGCAGTGGGGTGAAGGAACGGGACACTGACATGACATGACTTGACTGCCTGTTTGTACGAGATGGTGTGCGTGTGGATTGACGTCTGATCATGGTCGGTTGGTGATGGCTTGTGCAGACCGACAAAGCCTCTATGCTGGATGAAATTATCGAGTATGTGAAATTTCTGCAACTGCAAGTTAAGGTGAGTTGCACGGGATCTCTCTCTCTCTCT

mRNA

>Mapoly0502s0001.1
ATCCTTCAGGGGGGCATCTGCCTTGCCTTCCTTCTCACTTGACGCTGCCCCCCTCGGCCCACTGACTGCTTCTTGTTCCCCCCTCGGGCCTCGGTTGCCTTGCCTGCGAATGTGCCTGCCTTCCTTCCGTCCGTCCAAAATCCCCCCCCAAGCCCCTTGAGAGAGACTGAGACTCAGACTCTGAGGGAGAGAGAGAGAGAGTGGTGAGAGAGTGAGTGAGAGAAAGAGAAAGAGAAGTGAGAGAGAGAGAGAGAGAGAGAAAGAAGGAAGAGAGGAGAGATGCCTCCCCCGGATCACTCAGGCGCAGCAGGGTCCCGTTCATGGCAGCGCAGCAGGGAGTCGTCGTAGGAGTCTCATCGTCGTTGTCGTCGGCGCATCGCTTGTTGCTCGGAGGAGGCCCAGGAGGCCCATCGTCGCCCGGTCCGACGCAGAGCCCGTCCTCCTCCTGCTGCCCCACCTCGTGCTCGCCCAGCCTCCAGGCGTCGGCCAGGACACTGCTGGGCTGCTCCTTGCCCCCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGGGATCAGCAGCCTTGGCCTCCGCGGCTGCGCTGGTGGTATCGACCCAGACTTGCTCTAGTAGCCAGGCCCAGCAGTATCAGTATCAGCAGCGTCGCTGCAATCCTGCGGCTGCGGCCTTCCATCATCATCAGCTGCAGCAGCAGCAGGCCCAGCCCCCATTCTTGAGCCCTCCTGCTCTTCAAGCGTTGCTGCCGAGCGGAGCGCACTCTGAGATGCAACCGGCTTCCATGCTGGGCTCGCGTGGCCCGGTGCCCGGCGTCAGCAGCGCTCGCTCCTCGCTTAGCAATGCGGCGCTCGCCATGCCTTCTCTCCTGAGCCCCCCTCACCAACAGCCCGCGCTGCAATTCGAGCAGGCGGAGCAGACTCCCCCCATGGATGAATTTCTCGAGCAAATGTTCTCGCTCCCGTCCTGGTCCGAAATGGCGGGCGCCGGCCGCGCCCCCTGGGAATTCAATGCTGCGGCCGCCGGCGCTGCCACGCGCCTGGGCGTCGACGCCCAGAAGCTCTTCACCATGTCGTTGCTGCCCCCCGGATTGCTGGGCGGCCCGCACACCTCCACCACCACCACCAACAACAACAACACCAACAACAACAATGCCACCAGCAACAACAACAACAACCACAGCGGCCGCGATTTGCAAGACGGAGCCGATTCCGCCCACGTCGGCGATTCGGTCCTCGGCTATTCCAACGACGATCACCTGCTCGGTGCTCGCCTGCGCGGCCTGCAAGAAACTCCCTCATCCGTTCCAGGTATCGGAACTCGAGCAGGAGCGACTCTGACCAGGTCCCCGTCCGTAGGAAGCAGCGGAAGCGAAGGATCAGGTGGACCCCAATCGCCTCCTCCCATTGCCCCGACATGGAGGCAGCCATACGTAGGTGGCGTCCCACCTTTGCCATTGGGTTTAGGACAAGCAAAACCAGAAACGCTTCTTCGTGGTGACTCCGGAGAAGCGCATCTTCTTGGGAAAAGGCCTCGTGATGAGGACGAGGTCTCCATGAGAGAGGCTCATACAGGGAACAATGTTCGCGATGCACCGCAAGGACTTTTCGCCTCCTTCACCGGTGGCCAAGTGACCCAGAACCAAGTGCCTCGCTCAGCTGGGCAACAGTCCCATCAGCAGGGAAATGGTGCCTCGTCTCAAGGGGTGCAAGGACAAGGACAAGCGCTGCCCACGTACGGGAGCCCCTCGATAACGGCGACGACGCAACCCCATTCGAATTCGGGTGTGGCCGTGGCAGCTCGACCTCGAGTCCGAGCGCGACGTGGCCAAGCCACCGATCCGCACAGCATTGCCGAGAGGCTCCGAAGAGAAAGGATAGCGGAGAGAATGAAGGCATTGCAGGAGCTCGTGCCCAATTCAAACAAGACCGACAAAGCCTCTATGCTGGATGAAATTATCGAGTATGTGAAATTTCTGCAACTGCAAGTTAAGGTGAGTTGCACGGGATCTCTCTCTCTCTCT

CDS

>Mapoly0502s0001.1
ATGGCAGCGCAGCAGGGAGTCGTCGTAGGAGTCTCATCGTCGTTGTCGTCGGCGCATCGCTTGTTGCTCGGAGGAGGCCCAGGAGGCCCATCGTCGCCCGGTCCGACGCAGAGCCCGTCCTCCTCCTGCTGCCCCACCTCGTGCTCGCCCAGCCTCCAGGCGTCGGCCAGGACACTGCTGGGCTGCTCCTTGCCCCCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGGGATCAGCAGCCTTGGCCTCCGCGGCTGCGCTGGTGGTATCGACCCAGACTTGCTCTAGTAGCCAGGCCCAGCAGTATCAGTATCAGCAGCGTCGCTGCAATCCTGCGGCTGCGGCCTTCCATCATCATCAGCTGCAGCAGCAGCAGGCCCAGCCCCCATTCTTGAGCCCTCCTGCTCTTCAAGCGTTGCTGCCGAGCGGAGCGCACTCTGAGATGCAACCGGCTTCCATGCTGGGCTCGCGTGGCCCGGTGCCCGGCGTCAGCAGCGCTCGCTCCTCGCTTAGCAATGCGGCGCTCGCCATGCCTTCTCTCCTGAGCCCCCCTCACCAACAGCCCGCGCTGCAATTCGAGCAGGCGGAGCAGACTCCCCCCATGGATGAATTTCTCGAGCAAATGTTCTCGCTCCCGTCCTGGTCCGAAATGGCGGGCGCCGGCCGCGCCCCCTGGGAATTCAATGCTGCGGCCGCCGGCGCTGCCACGCGCCTGGGCGTCGACGCCCAGAAGCTCTTCACCATGTCGTTGCTGCCCCCCGGATTGCTGGGCGGCCCGCACACCTCCACCACCACCACCAACAACAACAACACCAACAACAACAATGCCACCAGCAACAACAACAACAACCACAGCGGCCGCGATTTGCAAGACGGAGCCGATTCCGCCCACGTCGGCGATTCGGTCCTCGGCTATTCCAACGACGATCACCTGCTCGGTGCTCGCCTGCGCGGCCTGCAAGAAACTCCCTCATCCGTTCCAGGTATCGGAACTCGAGCAGGAGCGACTCTGACCAGGTCCCCGTCCGTAGGAAGCAGCGGAAGCGAAGGATCAGGTGGACCCCAATCGCCTCCTCCCATTGCCCCGACATGGAGGCAGCCATACGTAGGTGGCGTCCCACCTTTGCCATTGGGTTTAGGACAAGCAAAACCAGAAACGCTTCTTCGTGGTGACTCCGGAGAAGCGCATCTTCTTGGGAAAAGGCCTCGTGATGAGGACGAGGTCTCCATGAGAGAGGCTCATACAGGGAACAATGTTCGCGATGCACCGCAAGGACTTTTCGCCTCCTTCACCGGTGGCCAAGTGACCCAGAACCAAGTGCCTCGCTCAGCTGGGCAACAGTCCCATCAGCAGGGAAATGGTGCCTCGTCTCAAGGGGTGCAAGGACAAGGACAAGCGCTGCCCACGTACGGGAGCCCCTCGATAACGGCGACGACGCAACCCCATTCGAATTCGGGTGTGGCCGTGGCAGCTCGACCTCGAGTCCGAGCGCGACGTGGCCAAGCCACCGATCCGCACAGCATTGCCGAGAGGCTCCGAAGAGAAAGGATAGCGGAGAGAATGAAGGCATTGCAGGAGCTCGTGCCCAATTCAAACAAGACCGACAAAGCCTCTATGCTGGATGAAATTATCGAGTATGTGAAATTTCTGCAACTGCAAGTTAAGGTGAGTTGCACGGGATCTCTCTCTCTCTCT

Protein

>Mapoly0502s0001.1
MAAQQGVVVGVSSSLSSAHRLLLGGGPGGPSSPGPTQSPSSSCCPTSCSPSLQASARTLLGCSLPPAAAAAAAAAAGSAALASAAALVVSTQTCSSSQAQQYQYQQRRCNPAAAAFHHHQLQQQQAQPPFLSPPALQALLPSGAHSEMQPASMLGSRGPVPGVSSARSSLSNAALAMPSLLSPPHQQPALQFEQAEQTPPMDEFLEQMFSLPSWSEMAGAGRAPWEFNAAAAGAATRLGVDAQKLFTMSLLPPGLLGGPHTSTTTTNNNNTNNNNATSNNNNNHSGRDLQDGADSAHVGDSVLGYSNDDHLLGARLRGLQETPSSVPGIGTRAGATLTRSPSVGSSGSEGSGGPQSPPPIAPTWRQPYVGGVPPLPLGLGQAKPETLLRGDSGEAHLLGKRPRDEDEVSMREAHTGNNVRDAPQGLFASFTGGQVTQNQVPRSAGQQSHQQGNGASSQGVQGQGQALPTYGSPSITATTQPHSNSGVAVAARPRVRARRGQATDPHSIAERLRRERIAERMKALQELVPNSNKTDKASMLDEIIEYVKFLQLQVKVSCTGSLSLS

Mapoly0502s0001.2  

Gene structure:

mRNA scaffold_502:2..4716  ( - strand )
CDS scaffold_502:2..97  ( - strand )
CDS scaffold_502:1889..1954  ( - strand )
CDS scaffold_502:2144..2323  ( - strand )
CDS scaffold_502:2499..2597  ( - strand )
CDS scaffold_502:3108..3229  ( - strand )
CDS scaffold_502:3415..4396  ( - strand )
five_prime_UTR scaffold_502:4397..4716  ( - strand )

Sequences:

Gene

>Mapoly0502s0001.2
ATCCTTCAGGGGGGCATCTGCCTTGCCTTCCTTCTCACTTGACGCTGCCCCCCTCGGCCCACTGACTGCTTCTTGTTCCCCCCTCGGGCCTCGGTTGCCTTGCCTGCGAATGTGCCTGCCTTCCTTCCGTCCGTCCAAAATCCCCCCCCAAGCCCCTTGAGAGAGACTGAGACTCAGACTCTGAGGGAGAGAGAGAGAGAGTGGTGAGAGAGTGAGTGAGAGAAAGAGAAAGAGAAGTGAGAGAGAGAGAGAGAGAGAGAAAGAAGGAAGAGAGGAGAGATGCCTCCCCCGGATCACTCAGGCGCAGCAGGGTCCCGTTCATGGCAGCGCAGCAGGGAGTCGTCGTAGGAGTCTCATCGTCGTTGTCGTCGGCGCATCGCTTGTTGCTCGGAGGAGGCCCAGGAGGCCCATCGTCGCCCGGTCCGACGCAGAGCCCGTCCTCCTCCTGCTGCCCCACCTCGTGCTCGCCCAGCCTCCAGGCGTCGGCCAGGACACTGCTGGGCTGCTCCTTGCCCCCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGGGATCAGCAGCCTTGGCCTCCGCGGCTGCGCTGGTGGTATCGACCCAGACTTGCTCTAGTAGCCAGGCCCAGCAGTATCAGTATCAGCAGCGTCGCTGCAATCCTGCGGCTGCGGCCTTCCATCATCATCAGCTGCAGCAGCAGCAGGCCCAGCCCCCATTCTTGAGCCCTCCTGCTCTTCAAGCGTTGCTGCCGAGCGGAGCGCACTCTGAGATGCAACCGGCTTCCATGCTGGGCTCGCGTGGCCCGGTGCCCGGCGTCAGCAGCGCTCGCTCCTCGCTTAGCAATGCGGCGCTCGCCATGCCTTCTCTCCTGAGCCCCCCTCACCAACAGCCCGCGCTGCAATTCGAGCAGGCGGAGCAGACTCCCCCCATGGATGAATTTCTCGAGCAAATGTTCTCGCTCCCGTCCTGGTCCGAAATGGCGGGCGCCGGCCGCGCCCCCTGGGAATTCAATGCTGCGGCCGCCGGCGCTGCCACGCGCCTGGGCGTCGACGCCCAGAAGCTCTTCACCATGTCGTTGCTGCCCCCCGGATTGCTGGGCGGCCCGCACACCTCCACCACCACCACCAACAACAACAACACCAACAACAACAATGCCACCAGCAACAACAACAACAACCACAGCGGCCGCGATTTGCAAGACGGAGCCGATTCCGCCCACGTCGGCGATTCGGTCCTCGGCTATTCCAACGACGATCACCTGCTCGGTGCTCGCCTGCGCGGCCTGCAAGAAACTCCCTCATCCGTTCCAGGTACACGCAATTTCCCTCCCCCGCATTCTGATTCGCCCCGGCGGGCCTCCCATTGGGATTCAATGCCGATCACCGCGCCAGCCATCGGAATCGACGCAATTCCCTCGTGTGTCGTGTGCTTTTGACAATGCCGCAGGTGCTGTGCTGTACTAACCGCTCAATTCGATTCGATCAATTCTCTCCAGGTATCGGAACTCGAGCAGGAGCGACTCTGACCAGGTCCCCGTCCGTAGGAAGCAGCGGAAGCGAAGGATCAGGTGGACCCCAATCGCCTCCTCCCATTGCCCCGACATGGAGGCAGCCATACGTAGGTGGCGTCCCACCTTTGCCATTGGGTTTAGGACAAGCAAAACCAGAAACGCTTCTTCGTGGTGACTCCGGAGAAGCGCATCTTCTTGGGAAAAGGCCTCGTGATGAGGACGAGGTCTCCATGAGAGAGGCTCATACAGGGAACAATGTGAGTCCGTGTTGCAGGCGAATTGCACTTGCTTCCATTGCTTCGAGCTCCGTAGGGCTTGAGAGAGACATAGACATAGACATTGAGAGAGAGCTTCGTATCTAGACGACGAGAGTGGGAGAGAGAGAGAGATTAAAGAGTGACTCTCGTCGTCTCGCAACCCTCTCTCCCTCATCATCATCGTCACCGTCATCATGCTGCTGCTGCTGCTGGCTCTCTAGAGTTTTCAGTGAACGATTTGAGTCTCTTCTCGTCTCGGTGATAGTGAATTTGGTCAAGGTGTTCGTCGCGAATTGGACGAGCGAGCACCGCTTTCTAGTCTCTTAACATTGAGGGCAACCTGTCTGATCGTCGTCGCAGGTTCGCGATGCACCGCAAGGACTTTTCGCCTCCTTCACCGGTGGCCAAGTGACCCAGAACCAAGTGCCTCGCTCAGCTGGGCAACAGTCCCATCAGCAGGTTGGCAAGCTCGACAGCCTCGTGTTGCTTTGAATGGATGATTGAATGAGTTAAAGAGACTGAGCTCCGCCGAGAGCATGATGGTATTGCGGAAGGGTTTGCAGCGAGGCGACACGAAGGGCACGAATCGAATGTGAGCTGAAATTGTGTTGTGCTGTGGCTCGCTACCTCGCAGGGAAATGGTGCCTCGTCTCAAGGGGTGCAAGGACAAGGACAAGCGCTGCCCACGTACGGGAGCCCCTCGATAACGGCGACGACGCAACCCCATTCGAATTCGGGTGTGGCCGTGGCAGCTCGACCTCGAGTCCGAGCGCGACGTGGCCAAGCCACCGATCCGCACAGCATTGCCGAGAGGGTGAGCTTTCCCGCGCTCTTCGCAATGTGACCAACCAATCAATCGTCCATCGCAGTCTAAACTTGGGCTCTCGCTCGCAAGTCCCGGCTGGATTTTCGAGGGCTCTCGAGATTGTTGCGCCCACAATGTGCCTGCCTGCCTGCCTGCGTCTCACGTGCGTGGCTCGTTTTGCTCTTGTGTGCCCTCCAGCTCCGAAGAGAAAGGATAGCGGAGAGAATGAAGGCATTGCAGGAGCTCGTGCCCAATTCAAACAAGGTGAGATTCTCCCTTTCCCTCTCTTTTCTTTCTCGTCCGCGTGCCGTGGCGCGACCTGACCCTCCTCGACCTCGTCCTCGTCCTCTTCTTCTTGAACCCCCATGATCAGATCAGCGTCCGTTGCTCTAGGGCCGTGTGATGATAGCTCGTAGAACTGGCGGACGTCATCATCATTCATGCCACTAATGCGCAAGTCCCCTCACAGAACCAAGATCGCTCGGACTCGATTCGGACTCGGAACTCGGAACATTGGAACTAAGCTCCAGACGACCGAATTTCTCTGACGGGATTGATCAGTCGCTCTCTCGTGAGGCTCGAGCCATGAGAGAAACAATTGGCGAGATTTGCGCAATTGATTGCCAGCAGCGAAAGATTGAGCCGAGCAGCAGGCGGGGGAAGAATGCAGTAGACTAGATGCGGTATCATTCGGTTGGACTGTCACAGGGATGTTCGCCCCCACCGACCCGACCGAGCGACCGAGGCAGCGAGACGAGCATAGGTCCAATATCTTTCACGATGTCTCGTGGCTCGTGGACTTGTGCCCATCGTTCTTTACAGTTGTCAGCCTACTGCTACTGCGCTTTGAGACCGAACGGTGGGTCGGGGGGCTGGGGCTGGGGCTGGGGTTAGGAAGAAGGCAGCGGGGCTTCGGTACGGCAGGTAAGCCCCGAGGCGGAGAATCTTCGACATACATTGAAGCGGGGCAGTATTCACGCAGGAAGCAGCGGCGGTCGCCTCATTGCTCGAGGCCATATCATTCTCGTAGCTCGCTTTCGGCGCAGCTGTGCGTGAGCCCAATCCGCTCGACCGGCCAATGGCTCACGTCCCGAGCTGCCTACTCTCCTCGACCTGGCCTGTCGAGACGGATCCAATGCGGCTACGACTCGTAGCCCAGCCACCCCTTCCCTTGCCGGGGGTGGGGAATGCGCTGCAGGGGGCTTGAGAAGCTTGCCGGCTGCGGAGTCGGACGGATCTCTCGCTTCCCTCCGAGGGAGAGAGGCGAAGGCGAGCCTCTTTTCCCCGTCGCTGAGCTTCCATAATTGGTCCCCAAGTCGGAGATGACACTCGCTCAGCGAGCACGATTTCTGCACTGCGGGACGTGCTCTGAGTCGATGATCAGATTCGGTTTCGTGAGAACGCTCAGATCAGCTCCGAGCGTGTAATCACTTCGAGCCCGTGATCGCAGATCCGGTGCTCCGGATGTGTGCATGTGCAGATCAATGTGCCTCTTTGGCCTGCTGCCGAATCGTGGACCTCGCTCGTTCTCATTCGATCCGCCCGCGAAGATAGATGAGTGATGAGTGGAGTTTCCTGCTGGCCCCGAAATCTTCCACCGCGCGAGGAGACGTGCAACAATTCTCGCACTGGTGAGTACGGCGCTTCGGCCGCGTACTTGCTCGTGCTCGCATCGTACCACATTTACGTTATGGACCTGTGGGATTCACCTGAGATCATCGAGCGCTTAATTGCCGCTCAGTACAGCGTCGAATAGCACTGGCACCGCGAGGAGTAAATTCCCGTTCGTCGTCACGTGAGCTGCTTTGCTGAAGCATCGGCTCTTATGAGCCCATGGCAATCTGATAGGACGCAGAAAGCCGTGAGCTGCATCTGAAATCATGCTCATCCGGAGCCGTCTGTGTGTCTGGTGCTCGACGGTACATTTTGGTCGAGGCTGGCAGTGGGGTGAAGGAACGGGACACTGACATGACATGACTTGACTGCCTGTTTGTACGAGATGGTGTGCGTGTGGATTGACGTCTGATCATGGTCGGTTGGTGATGGCTTGTGCAGACCGACAAAGCCTCTATGCTGGATGAAATTATCGAGTATGTGAAATTTCTGCAACTGCAAGTTAAGGTGAGTTGCACGGGATCTCTCTCTCTCTCT

mRNA

>Mapoly0502s0001.2
ATCCTTCAGGGGGGCATCTGCCTTGCCTTCCTTCTCACTTGACGCTGCCCCCCTCGGCCCACTGACTGCTTCTTGTTCCCCCCTCGGGCCTCGGTTGCCTTGCCTGCGAATGTGCCTGCCTTCCTTCCGTCCGTCCAAAATCCCCCCCCAAGCCCCTTGAGAGAGACTGAGACTCAGACTCTGAGGGAGAGAGAGAGAGAGTGGTGAGAGAGTGAGTGAGAGAAAGAGAAAGAGAAGTGAGAGAGAGAGAGAGAGAGAGAAAGAAGGAAGAGAGGAGAGATGCCTCCCCCGGATCACTCAGGCGCAGCAGGGTCCCGTTCATGGCAGCGCAGCAGGGAGTCGTCGTAGGAGTCTCATCGTCGTTGTCGTCGGCGCATCGCTTGTTGCTCGGAGGAGGCCCAGGAGGCCCATCGTCGCCCGGTCCGACGCAGAGCCCGTCCTCCTCCTGCTGCCCCACCTCGTGCTCGCCCAGCCTCCAGGCGTCGGCCAGGACACTGCTGGGCTGCTCCTTGCCCCCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGGGATCAGCAGCCTTGGCCTCCGCGGCTGCGCTGGTGGTATCGACCCAGACTTGCTCTAGTAGCCAGGCCCAGCAGTATCAGTATCAGCAGCGTCGCTGCAATCCTGCGGCTGCGGCCTTCCATCATCATCAGCTGCAGCAGCAGCAGGCCCAGCCCCCATTCTTGAGCCCTCCTGCTCTTCAAGCGTTGCTGCCGAGCGGAGCGCACTCTGAGATGCAACCGGCTTCCATGCTGGGCTCGCGTGGCCCGGTGCCCGGCGTCAGCAGCGCTCGCTCCTCGCTTAGCAATGCGGCGCTCGCCATGCCTTCTCTCCTGAGCCCCCCTCACCAACAGCCCGCGCTGCAATTCGAGCAGGCGGAGCAGACTCCCCCCATGGATGAATTTCTCGAGCAAATGTTCTCGCTCCCGTCCTGGTCCGAAATGGCGGGCGCCGGCCGCGCCCCCTGGGAATTCAATGCTGCGGCCGCCGGCGCTGCCACGCGCCTGGGCGTCGACGCCCAGAAGCTCTTCACCATGTCGTTGCTGCCCCCCGGATTGCTGGGCGGCCCGCACACCTCCACCACCACCACCAACAACAACAACACCAACAACAACAATGCCACCAGCAACAACAACAACAACCACAGCGGCCGCGATTTGCAAGACGGAGCCGATTCCGCCCACGTCGGCGATTCGGTCCTCGGCTATTCCAACGACGATCACCTGCTCGGTGCTCGCCTGCGCGGCCTGCAAGAAACTCCCTCATCCGTTCCAGGTATCGGAACTCGAGCAGGAGCGACTCTGACCAGGTCCCCGTCCGTAGGAAGCAGCGGAAGCGAAGGATCAGGTGGACCCCAATCGCCTCCTCCCATTGCCCCGACATGGAGGCAGCCATACGTTCGCGATGCACCGCAAGGACTTTTCGCCTCCTTCACCGGTGGCCAAGTGACCCAGAACCAAGTGCCTCGCTCAGCTGGGCAACAGTCCCATCAGCAGGGAAATGGTGCCTCGTCTCAAGGGGTGCAAGGACAAGGACAAGCGCTGCCCACGTACGGGAGCCCCTCGATAACGGCGACGACGCAACCCCATTCGAATTCGGGTGTGGCCGTGGCAGCTCGACCTCGAGTCCGAGCGCGACGTGGCCAAGCCACCGATCCGCACAGCATTGCCGAGAGGCTCCGAAGAGAAAGGATAGCGGAGAGAATGAAGGCATTGCAGGAGCTCGTGCCCAATTCAAACAAGACCGACAAAGCCTCTATGCTGGATGAAATTATCGAGTATGTGAAATTTCTGCAACTGCAAGTTAAGGTGAGTTGCACGGGATCTCTCTCTCTCTCT

CDS

>Mapoly0502s0001.2
ATGGCAGCGCAGCAGGGAGTCGTCGTAGGAGTCTCATCGTCGTTGTCGTCGGCGCATCGCTTGTTGCTCGGAGGAGGCCCAGGAGGCCCATCGTCGCCCGGTCCGACGCAGAGCCCGTCCTCCTCCTGCTGCCCCACCTCGTGCTCGCCCAGCCTCCAGGCGTCGGCCAGGACACTGCTGGGCTGCTCCTTGCCCCCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGGGATCAGCAGCCTTGGCCTCCGCGGCTGCGCTGGTGGTATCGACCCAGACTTGCTCTAGTAGCCAGGCCCAGCAGTATCAGTATCAGCAGCGTCGCTGCAATCCTGCGGCTGCGGCCTTCCATCATCATCAGCTGCAGCAGCAGCAGGCCCAGCCCCCATTCTTGAGCCCTCCTGCTCTTCAAGCGTTGCTGCCGAGCGGAGCGCACTCTGAGATGCAACCGGCTTCCATGCTGGGCTCGCGTGGCCCGGTGCCCGGCGTCAGCAGCGCTCGCTCCTCGCTTAGCAATGCGGCGCTCGCCATGCCTTCTCTCCTGAGCCCCCCTCACCAACAGCCCGCGCTGCAATTCGAGCAGGCGGAGCAGACTCCCCCCATGGATGAATTTCTCGAGCAAATGTTCTCGCTCCCGTCCTGGTCCGAAATGGCGGGCGCCGGCCGCGCCCCCTGGGAATTCAATGCTGCGGCCGCCGGCGCTGCCACGCGCCTGGGCGTCGACGCCCAGAAGCTCTTCACCATGTCGTTGCTGCCCCCCGGATTGCTGGGCGGCCCGCACACCTCCACCACCACCACCAACAACAACAACACCAACAACAACAATGCCACCAGCAACAACAACAACAACCACAGCGGCCGCGATTTGCAAGACGGAGCCGATTCCGCCCACGTCGGCGATTCGGTCCTCGGCTATTCCAACGACGATCACCTGCTCGGTGCTCGCCTGCGCGGCCTGCAAGAAACTCCCTCATCCGTTCCAGGTATCGGAACTCGAGCAGGAGCGACTCTGACCAGGTCCCCGTCCGTAGGAAGCAGCGGAAGCGAAGGATCAGGTGGACCCCAATCGCCTCCTCCCATTGCCCCGACATGGAGGCAGCCATACGTTCGCGATGCACCGCAAGGACTTTTCGCCTCCTTCACCGGTGGCCAAGTGACCCAGAACCAAGTGCCTCGCTCAGCTGGGCAACAGTCCCATCAGCAGGGAAATGGTGCCTCGTCTCAAGGGGTGCAAGGACAAGGACAAGCGCTGCCCACGTACGGGAGCCCCTCGATAACGGCGACGACGCAACCCCATTCGAATTCGGGTGTGGCCGTGGCAGCTCGACCTCGAGTCCGAGCGCGACGTGGCCAAGCCACCGATCCGCACAGCATTGCCGAGAGGCTCCGAAGAGAAAGGATAGCGGAGAGAATGAAGGCATTGCAGGAGCTCGTGCCCAATTCAAACAAGACCGACAAAGCCTCTATGCTGGATGAAATTATCGAGTATGTGAAATTTCTGCAACTGCAAGTTAAGGTGAGTTGCACGGGATCTCTCTCTCTCTCT

Protein

>Mapoly0502s0001.2
MAAQQGVVVGVSSSLSSAHRLLLGGGPGGPSSPGPTQSPSSSCCPTSCSPSLQASARTLLGCSLPPAAAAAAAAAAGSAALASAAALVVSTQTCSSSQAQQYQYQQRRCNPAAAAFHHHQLQQQQAQPPFLSPPALQALLPSGAHSEMQPASMLGSRGPVPGVSSARSSLSNAALAMPSLLSPPHQQPALQFEQAEQTPPMDEFLEQMFSLPSWSEMAGAGRAPWEFNAAAAGAATRLGVDAQKLFTMSLLPPGLLGGPHTSTTTTNNNNTNNNNATSNNNNNHSGRDLQDGADSAHVGDSVLGYSNDDHLLGARLRGLQETPSSVPGIGTRAGATLTRSPSVGSSGSEGSGGPQSPPPIAPTWRQPYVRDAPQGLFASFTGGQVTQNQVPRSAGQQSHQQGNGASSQGVQGQGQALPTYGSPSITATTQPHSNSGVAVAARPRVRARRGQATDPHSIAERLRRERIAERMKALQELVPNSNKTDKASMLDEIIEYVKFLQLQVKVSCTGSLSLS

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>