Mapoly0811s0001



Description

SWI/SNF COMPLEX-RELATED

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_164517
PFAM PF00249 Myb-like DNA-binding domain
PANTHER PTHR12802 SWI/SNF COMPLEX-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp1R-MYB22 transcription factor, MYB Mapoly0811s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0811s0001.1 scaffold_811:2..3304  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0811s0001.1  

Gene structure:

mRNA scaffold_811:2..3304  ( + strand )
five_prime_UTR scaffold_811:2..476  ( + strand )
CDS scaffold_811:477..623  ( + strand )
CDS scaffold_811:1148..1201  ( + strand )
CDS scaffold_811:1372..1433  ( + strand )
CDS scaffold_811:1599..1692  ( + strand )
CDS scaffold_811:1842..1934  ( + strand )
three_prime_UTR scaffold_811:1935..3304  ( + strand )

Sequences:

Gene

>Mapoly0811s0001.1
AGAGAGAGAGAGAGGCTGCGCTGTGTCGTGCTGTGCGCCCAGCGAGCGACGACCTGGGTCAGGTGTTGGCCGGCATTGAATTGAGGTACAGGTGCTGTCGATGGTGGAGGGAGGTCCGAGACTTGTCACCGATTTCGTCCGACACTTGATGGAATTGCCTACAGATTCAGCTACTACTTTCGTAATCAACGTGAATGTGCTGAGCGATGGAGGCATGAGTCCTCAGAGGAGAGGAGGAGCGGCGTAGGGTTGTTGTTGTAGCTGCTGACTCGTGGTGCTGCTTTCCGTCCCCTGCGCGGCCGGCCGTCTTCCATAGCTGCTCGCCATCTGATCCCTTCACATTAGAGGAACTTGCAGCAGGCGAGTTCTGTTGCGCACCCTTCTGTTGACCGTCTCTGCGTGCTCGTCCACCTCCTCGTCGTCGTGGTGCTAGTTGGGGAGATTCGGCCACCGGAGAACAGGAGAACAGGCGCCCATGGATAAGAGTGAACCCATGCAGATGGCATCATCCGCCAGACCTTGCGCGAAAACTGCCCCAGAGCAACATTATGTGCAGATAGATTCGTTGGGATTGCAACAACTTGAGCATCTGGAGAAGGAGCTTGAACAAGCCAAACAAAAGGTCAGAATGTCCGAAACAGGTTGAAACTTGTCAGACTTGTGTTAACTTAACTGTCAGCACTTTAGCCATTCGACATTCTCTAAGACCGCAGATAATGGATCGATCGTTCGAGCACAGACCTCACGAACCCCGAGTTCTGGTCAGCAATTTCAATTAAGTAACTTTTCTGAAACCAACGACAAAGTGCTTACGAGGTATTTTTAGCGAAATTTCTTCTCGACGCCGATATCAGCTCATAAACATGAAGTAGTTGCAAGGTCTAGTGTTTTACCCTGTCTTTGGAGGCTGAGAGAGAGTCTGGCAATCGCCAGAACAGCGACAGAGTGTCGCACGAACTGCTATGAGAACCATGATGAAGTGATGATGATGATCAAGCAAATAGTGGGAGTGATAAATTAGAGAGAATCTCGCCCGCATCTGAAATTTTGTCCAGGGCTTGGTGCTTCGGTTTGAGCAGTATATTCAAGGAAGACAGTCTCAGACAGAATCCCTGAATGCCTGTCAGTACGATGTCGCTTTGACAGATTCTAGTACTGAGAGCGCAGGAACATCGGGAGACATCTTCGCCAGAGAACAAGGTAAATCAATTCAAGTCCAGTTGACTGAAACCTTTCCTGCCTCCCTCCTTCGAAACCGTTCCACCTGCGATTCGTTTGCACTGCTTCGTTGTCACATAGCATCCAACTGAATCCTTCACTCGAGCGATGAGCTCCGCAATCGCGCTGTGATATTCTCGATGCATGGGCAGGTCTCCGAAAGCAGATATTGGACCAACGAGGAACGGCAACGGTTCAAGAAAGCTCTGAAGACGTGAGTAAACATGATGATAGATGCAGCCTCAGGAATTTCCTTTAGCAGCAGGAAGAATGTTGTGCCAATCCTAATCTGAAAACAATGTCTCCGAGTTTTGTTCCGAATTCCTGCATGCAATAGCTGCGAATGAATGACGCTGTCAGACGTGGACGGATGATACAGCTTTGGGACCGACTTTGCGGCTATCGCAAAGTTCGTAGGAACGCGCAGTTCCACTCAAGTCCGGACGCATGCGCAGAAGTATTATGCTAAGCTGGTGCGTACTACGCCCCCATCCACTTGCTTGCGGCAGGCCTGACAGAGTTCGTCGAACCTTGTGCATGGTGCACTCGTCGGTTGCAACTTTGCTGTGCAGGTCTCGTGGATCCCAGACTCTCACGAGTTTGTTTGTTAGCTCTCGTGCAGATCAGAGACTACAAACGTTCTGGCAAATCTCCGGCGACAGTCAAAGGCCGTGAGGAGAAAGCGACCGGAGCAACTCGACTCACGACGATGTAAAAATGCCAGACGACTGCTGCTTGCTCCACATGCGCAAATAATGCGGTCGCATTTCAGACAGCATGCATGTCACGTGGTCGGAGGAGGAACATCCTGCAAGCCAGGAGGAGGATTAGGAGGAGGAGGAGGAGGGAGGGAGGGAGGGGTATCGCAGCTGGACTTGTTTCCTTCAGAGTCATGAATGTAGTCGTAGTCAGTCAGTAGTCACGAGAAATTTCACGCTACATGATCCTTGGACTGACGTCCTGCCCAAGGTGCTGCAATTTGATAGATTACGTGAAAAATGAGTTTTTAGAAGCAGGCAATAACGGCAGCCTAGCTACGTAGAGTAGGAGCTGTGTTGCGCCACGCCATGCCACGCCACGCCCAGTCTCGCTTAGCGAACGAGAGAAGTCTTCATTGTTACAGTTGTTACAGTTCTTCAAGAGAATAGAAGATGGGGGAGAATTTGGCAGCACTGTCTATCCGCGCCATCTCAAGTTTCTGAACCAGGTAACATTGGTCATGATTTTGCCATCAGATTTTATTCAACAATAGAGGGGAAATATATACAATCCTTTGCCCTGACCGTGACCGTGATCCATTCACAATTGTTGAATACTTACACTCACTCACTCACTCACAACGTCATGGCCGATGTTCCTTCCGACGAGCGAATTGGGAGCTACAATTGGGAGCATGTAACGTATTAGCTTCGGAATCATCCGCATGCTTTCGAGCAGAAGAGGCCAGATTTAGCCAGATTGTCTCCTGACCTCCATCGCTGCTTCTCCGCTCGGGGCTCCGGTCCGTCGAGTGTGCAATCAATCGTCGAGTGGCATCTGCACAGTGTGCCATGCGTGGTCCGCGGAAGCAAACTGGAATTCGGAAGAATCCGATCCCTGGATCTACGAGGAAGCGAACGCGACGAAGATCTGATTGCGCTGCTGGACACGTGTCCCGCTGGAGATTGGAAGGACTTCCCGAGGTCAGAGTCTTTCTATGCTCTTCGAATCTCGCACGCTGCTTCCCTCCTTCCGGTGCATGAATGCGACTGGCCTTCGGGAACGAGATCCTCAAGTCAATTCTCTTCGCTCTACCTCTCTGGCATCCACCAACCACTCCGGCTCCTCGTGCCGGCAGGAAGACGCCAAGCGATGGTCACGCACGATATCATCTGGAAATAGAAACCGGTCCATTCACGGATACAAGATCGAGATCGAGAGTGATGTCACCACTCACATGGACGCGCATCCTGCCAGGACTTACATTCCCGTTTTGGAGCATGACTCCTTGGGTTACATTGCATTCGTGTTTTCCAAATTTGTTCTCAACAGTATAAAGGTCCCCAGACGAAGGCTCTGTGCTCCAAACGCTCCTGGCAAAGGTCG

mRNA

>Mapoly0811s0001.1
AGAGAGAGAGAGAGGCTGCGCTGTGTCGTGCTGTGCGCCCAGCGAGCGACGACCTGGGTCAGGTGTTGGCCGGCATTGAATTGAGGTACAGGTGCTGTCGATGGTGGAGGGAGGTCCGAGACTTGTCACCGATTTCGTCCGACACTTGATGGAATTGCCTACAGATTCAGCTACTACTTTCGTAATCAACGTGAATGTGCTGAGCGATGGAGGCATGAGTCCTCAGAGGAGAGGAGGAGCGGCGTAGGGTTGTTGTTGTAGCTGCTGACTCGTGGTGCTGCTTTCCGTCCCCTGCGCGGCCGGCCGTCTTCCATAGCTGCTCGCCATCTGATCCCTTCACATTAGAGGAACTTGCAGCAGGCGAGTTCTGTTGCGCACCCTTCTGTTGACCGTCTCTGCGTGCTCGTCCACCTCCTCGTCGTCGTGGTGCTAGTTGGGGAGATTCGGCCACCGGAGAACAGGAGAACAGGCGCCCATGGATAAGAGTGAACCCATGCAGATGGCATCATCCGCCAGACCTTGCGCGAAAACTGCCCCAGAGCAACATTATGTGCAGATAGATTCGTTGGGATTGCAACAACTTGAGCATCTGGAGAAGGAGCTTGAACAAGCCAAACAAAAGATTCTAGTACTGAGAGCGCAGGAACATCGGGAGACATCTTCGCCAGAGAACAAGGTCTCCGAAAGCAGATATTGGACCAACGAGGAACGGCAACGGTTCAAGAAAGCTCTGAAGACCTTTGGGACCGACTTTGCGGCTATCGCAAAGTTCGTAGGAACGCGCAGTTCCACTCAAGTCCGGACGCATGCGCAGAAGTATTATGCTAAGCTGATCAGAGACTACAAACGTTCTGGCAAATCTCCGGCGACAGTCAAAGGCCGTGAGGAGAAAGCGACCGGAGCAACTCGACTCACGACGATGTAAAAATGCCAGACGACTGCTGCTTGCTCCACATGCGCAAATAATGCGGTCGCATTTCAGACAGCATGCATGTCACGTGGTCGGAGGAGGAACATCCTGCAAGCCAGGAGGAGGATTAGGAGGAGGAGGAGGAGGGAGGGAGGGAGGGGTATCGCAGCTGGACTTGTTTCCTTCAGAGTCATGAATGTAGTCGTAGTCAGTCAGTAGTCACGAGAAATTTCACGCTACATGATCCTTGGACTGACGTCCTGCCCAAGGTGCTGCAATTTGATAGATTACGTGAAAAATGAGTTTTTAGAAGCAGGCAATAACGGCAGCCTAGCTACGTAGAGTAGGAGCTGTGTTGCGCCACGCCATGCCACGCCACGCCCAGTCTCGCTTAGCGAACGAGAGAAGTCTTCATTGTTACAGTTGTTACAGTTCTTCAAGAGAATAGAAGATGGGGGAGAATTTGGCAGCACTGTCTATCCGCGCCATCTCAAGTTTCTGAACCAGGTAACATTGGTCATGATTTTGCCATCAGATTTTATTCAACAATAGAGGGGAAATATATACAATCCTTTGCCCTGACCGTGACCGTGATCCATTCACAATTGTTGAATACTTACACTCACTCACTCACTCACAACGTCATGGCCGATGTTCCTTCCGACGAGCGAATTGGGAGCTACAATTGGGAGCATGTAACGTATTAGCTTCGGAATCATCCGCATGCTTTCGAGCAGAAGAGGCCAGATTTAGCCAGATTGTCTCCTGACCTCCATCGCTGCTTCTCCGCTCGGGGCTCCGGTCCGTCGAGTGTGCAATCAATCGTCGAGTGGCATCTGCACAGTGTGCCATGCGTGGTCCGCGGAAGCAAACTGGAATTCGGAAGAATCCGATCCCTGGATCTACGAGGAAGCGAACGCGACGAAGATCTGATTGCGCTGCTGGACACGTGTCCCGCTGGAGATTGGAAGGACTTCCCGAGGTCAGAGTCTTTCTATGCTCTTCGAATCTCGCACGCTGCTTCCCTCCTTCCGGTGCATGAATGCGACTGGCCTTCGGGAACGAGATCCTCAAGTCAATTCTCTTCGCTCTACCTCTCTGGCATCCACCAACCACTCCGGCTCCTCGTGCCGGCAGGAAGACGCCAAGCGATGGTCACGCACGATATCATCTGGAAATAGAAACCGGTCCATTCACGGATACAAGATCGAGATCGAGAGTGATGTCACCACTCACATGGACGCGCATCCTGCCAGGACTTACATTCCCGTTTTGGAGCATGACTCCTTGGGTTACATTGCATTCGTGTTTTCCAAATTTGTTCTCAACAGTATAAAGGTCCCCAGACGAAGGCTCTGTGCTCCAAACGCTCCTGGCAAAGGTCG

CDS

>Mapoly0811s0001.1
ATGGATAAGAGTGAACCCATGCAGATGGCATCATCCGCCAGACCTTGCGCGAAAACTGCCCCAGAGCAACATTATGTGCAGATAGATTCGTTGGGATTGCAACAACTTGAGCATCTGGAGAAGGAGCTTGAACAAGCCAAACAAAAGATTCTAGTACTGAGAGCGCAGGAACATCGGGAGACATCTTCGCCAGAGAACAAGGTCTCCGAAAGCAGATATTGGACCAACGAGGAACGGCAACGGTTCAAGAAAGCTCTGAAGACCTTTGGGACCGACTTTGCGGCTATCGCAAAGTTCGTAGGAACGCGCAGTTCCACTCAAGTCCGGACGCATGCGCAGAAGTATTATGCTAAGCTGATCAGAGACTACAAACGTTCTGGCAAATCTCCGGCGACAGTCAAAGGCCGTGAGGAGAAAGCGACCGGAGCAACTCGACTCACGACGATGTAA

Protein

>Mapoly0811s0001.1
MDKSEPMQMASSARPCAKTAPEQHYVQIDSLGLQQLEHLEKELEQAKQKILVLRAQEHRETSSPENKVSESRYWTNEERQRFKKALKTFGTDFAAIAKFVGTRSSTQVRTHAQKYYAKLIRDYKRSGKSPATVKGREEKATGATRLTTM

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>