Mapoly0817s0001



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_150318
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED
PANTHER PTHR31301:SF3

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD19 transcription factor, ASL/LBD Mapoly0817s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0817s0001.1 scaffold_817:3106..4478  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0817s0001.1  

Gene structure:

mRNA scaffold_817:3106..4478  ( - strand )
three_prime_UTR scaffold_817:3106..3207  ( - strand )
CDS scaffold_817:3208..4101  ( - strand )
five_prime_UTR scaffold_817:4102..4478  ( - strand )

Sequences:

Gene

>Mapoly0817s0001.1
TTTCCAACAAGACGGGCTTTTTTTCTATTCGTGGCTGGATTTTAATTTAGCCAGCATTAGCTGCGTGTATTAAGAGACTCGTCCACACCTCGAGAGCCACATCTACAGCTACCGTCTTGTTGAAAAAGCGCAGAGTGGGGAGAAGAGTGTAGTAAGCTAGTCTTCTCCCCCTCGAGAGTCACAGATTCAGTTCCCGGCTTGTTGGAAAAGCGCAGAGTGGGGGCAAGAGTGTAGTAAGCGAGTCTTCTATCCCTCGGGAGTCACAGATACAAGTCCCGTCTTGTTATAAAAGCGCAGAGGCACAGATAGCCTGAGTCTATCCCTCGCTGAAGATCCGTCTACAGGAAGAGTTGAAGACACATATCTGATAAGTCCAAATGGAACAATTTCACGGCCTCACTCCACAGGTTTCAGGTGTTCAGGTTTCATCGAGAATGGGCTTCCCTCCGAATGGAGCGTGCGCTGCCTGCAAGTTCCAAAGGCGAAAGTGCACCGTGGATTGCTTACTGGCACCGTGGTTCCCTCCTCATCAGCCCAGGCGATTTGCGAACGCCCACAGGCTGTTCGGAGTCGCGCACATACTGAGATTAATTCAAGAAAATAAAAACTCAGTGGGCGATCTGATGAAAAGTGTGTGCTTCGAGTCCGACGCAAGGGAACGAGATCCTGTTCACGGAGTTTACGGGATACTGAGGCGTCTTAAGCGCGAGGCTGATATACTGGAGGAGCACAGGTCGACTTTGGCGGAGAAATTAAGGATTTTGAAGGCAGAAGATGCTGCAGCTCAAACTCCTGCGTTGTTTGCTCCTGCTTACAACGGTAATCATCCAGAAACTTATTATGGGCATGCGCGGCCTACTCAACATGTCGCGCCTACTCAACAGGTCTCGTTTCCCGAAAATGGAGGTTTTCATTTTTTCGCGCCTATCCAACAGGTCACGTTTCCCAAAAATGGAGGTTTTCATATGCAGCATCAGGTCGCGTTTCAGGATAATGGGGGCTTTCATATGCAGCAACAGCATCAGGAGACTGACATGTATCAGCTACAGCAGCAAATGAATCTCTTTGGTGGAGGAGGATTTACTCCGGTACAGCTAACGGGCGCTCCGATGCAACTCACGGATAGGAGTACATCGATGCAACTCACGGATAGAACCATGGTAACTCACGGGAACCACAACACCGTGGTTCCCGCAAGCGGTGATATATTCCCTGCTTCGCGATTGTGTTTGGACCTCTTCACGGACTCCCGCAGTTCCAGAATTGTGTAAGTTGGTGACGACGTTCAACGTCTTGGGACATCGTGAGGACGATGCAACGCGGTTGAGAGTTGTGGACAGAAGAACTGGGAATATTCACGTTGTTCTCACGAG

mRNA

>Mapoly0817s0001.1
TTTCCAACAAGACGGGCTTTTTTTCTATTCGTGGCTGGATTTTAATTTAGCCAGCATTAGCTGCGTGTATTAAGAGACTCGTCCACACCTCGAGAGCCACATCTACAGCTACCGTCTTGTTGAAAAAGCGCAGAGTGGGGAGAAGAGTGTAGTAAGCTAGTCTTCTCCCCCTCGAGAGTCACAGATTCAGTTCCCGGCTTGTTGGAAAAGCGCAGAGTGGGGGCAAGAGTGTAGTAAGCGAGTCTTCTATCCCTCGGGAGTCACAGATACAAGTCCCGTCTTGTTATAAAAGCGCAGAGGCACAGATAGCCTGAGTCTATCCCTCGCTGAAGATCCGTCTACAGGAAGAGTTGAAGACACATATCTGATAAGTCCAAATGGAACAATTTCACGGCCTCACTCCACAGGTTTCAGGTGTTCAGGTTTCATCGAGAATGGGCTTCCCTCCGAATGGAGCGTGCGCTGCCTGCAAGTTCCAAAGGCGAAAGTGCACCGTGGATTGCTTACTGGCACCGTGGTTCCCTCCTCATCAGCCCAGGCGATTTGCGAACGCCCACAGGCTGTTCGGAGTCGCGCACATACTGAGATTAATTCAAGAAAATAAAAACTCAGTGGGCGATCTGATGAAAAGTGTGTGCTTCGAGTCCGACGCAAGGGAACGAGATCCTGTTCACGGAGTTTACGGGATACTGAGGCGTCTTAAGCGCGAGGCTGATATACTGGAGGAGCACAGGTCGACTTTGGCGGAGAAATTAAGGATTTTGAAGGCAGAAGATGCTGCAGCTCAAACTCCTGCGTTGTTTGCTCCTGCTTACAACGGTAATCATCCAGAAACTTATTATGGGCATGCGCGGCCTACTCAACATGTCGCGCCTACTCAACAGGTCTCGTTTCCCGAAAATGGAGGTTTTCATTTTTTCGCGCCTATCCAACAGGTCACGTTTCCCAAAAATGGAGGTTTTCATATGCAGCATCAGGTCGCGTTTCAGGATAATGGGGGCTTTCATATGCAGCAACAGCATCAGGAGACTGACATGTATCAGCTACAGCAGCAAATGAATCTCTTTGGTGGAGGAGGATTTACTCCGGTACAGCTAACGGGCGCTCCGATGCAACTCACGGATAGGAGTACATCGATGCAACTCACGGATAGAACCATGGTAACTCACGGGAACCACAACACCGTGGTTCCCGCAAGCGGTGATATATTCCCTGCTTCGCGATTGTGTTTGGACCTCTTCACGGACTCCCGCAGTTCCAGAATTGTGTAAGTTGGTGACGACGTTCAACGTCTTGGGACATCGTGAGGACGATGCAACGCGGTTGAGAGTTGTGGACAGAAGAACTGGGAATATTCACGTTGTTCTCACGAG

CDS

>Mapoly0817s0001.1
ATGGAACAATTTCACGGCCTCACTCCACAGGTTTCAGGTGTTCAGGTTTCATCGAGAATGGGCTTCCCTCCGAATGGAGCGTGCGCTGCCTGCAAGTTCCAAAGGCGAAAGTGCACCGTGGATTGCTTACTGGCACCGTGGTTCCCTCCTCATCAGCCCAGGCGATTTGCGAACGCCCACAGGCTGTTCGGAGTCGCGCACATACTGAGATTAATTCAAGAAAATAAAAACTCAGTGGGCGATCTGATGAAAAGTGTGTGCTTCGAGTCCGACGCAAGGGAACGAGATCCTGTTCACGGAGTTTACGGGATACTGAGGCGTCTTAAGCGCGAGGCTGATATACTGGAGGAGCACAGGTCGACTTTGGCGGAGAAATTAAGGATTTTGAAGGCAGAAGATGCTGCAGCTCAAACTCCTGCGTTGTTTGCTCCTGCTTACAACGGTAATCATCCAGAAACTTATTATGGGCATGCGCGGCCTACTCAACATGTCGCGCCTACTCAACAGGTCTCGTTTCCCGAAAATGGAGGTTTTCATTTTTTCGCGCCTATCCAACAGGTCACGTTTCCCAAAAATGGAGGTTTTCATATGCAGCATCAGGTCGCGTTTCAGGATAATGGGGGCTTTCATATGCAGCAACAGCATCAGGAGACTGACATGTATCAGCTACAGCAGCAAATGAATCTCTTTGGTGGAGGAGGATTTACTCCGGTACAGCTAACGGGCGCTCCGATGCAACTCACGGATAGGAGTACATCGATGCAACTCACGGATAGAACCATGGTAACTCACGGGAACCACAACACCGTGGTTCCCGCAAGCGGTGATATATTCCCTGCTTCGCGATTGTGTTTGGACCTCTTCACGGACTCCCGCAGTTCCAGAATTGTGTAA

Protein

>Mapoly0817s0001.1
MEQFHGLTPQVSGVQVSSRMGFPPNGACAACKFQRRKCTVDCLLAPWFPPHQPRRFANAHRLFGVAHILRLIQENKNSVGDLMKSVCFESDARERDPVHGVYGILRRLKREADILEEHRSTLAEKLRILKAEDAAAQTPALFAPAYNGNHPETYYGHARPTQHVAPTQQVSFPENGGFHFFAPIQQVTFPKNGGFHMQHQVAFQDNGGFHMQQQHQETDMYQLQQQMNLFGGGGFTPVQLTGAPMQLTDRSTSMQLTDRTMVTHGNHNTVVPASGDIFPASRLCLDLFTDSRSSRIV

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>