Mapoly1011s0001



Description

(UnKnown)

Reference DB

Database ID Description

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCLE1 peptide hormone Mapoly1011s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly1011s0001.1 scaffold_1011:3800..5044  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly1011s0001.1  

Gene structure:

mRNA scaffold_1011:3800..5044  ( - strand )
CDS scaffold_1011:3800..4081  ( - strand )
CDS scaffold_1011:4651..4781  ( - strand )
CDS scaffold_1011:4969..5044  ( - strand )

Sequences:

Gene

>Mapoly1011s0001.1
ATGGGTGCCTTGACTTTGCGGATGCTCTTGGTTTTAACATTGGCGGTTATGACAGAATGCGGTCGTCCTCTTCAGAGTAATCCCCAGCGCCGCTCATTATTATTATCTTCGAATTGGTGCTCGTGAGCAATCGCCAGCTCCGTGCTCAGCTGGAATGCCATGGTGCAGATATATCTGAATTTCATGTCAATTGTGCGTGCTAGAGCCCCGTAGACTCATATCCCTCACGCTCGACTGACTCCTTGACTGATGCCACTGTCCAGGTTCGCATATGAGCTCATTGGTCATGTCCATGCTCCAGACTCCACCGAAACCACTGCAGCCGCCTCCTCTATCTCCTATACAGCGCGAACAGATGCTTCAGGCTCGCAAGCCCCCGTCTCCGACAGCTGAGGTGAGGAATTCGACTCAACCCGTGGAGATTCGCCCAAATCTGGGCTCGATGTAAAGATTGCATGCACGTGCTCGAGAATTCTCGAATTTTGACTTTGTATTGGATCCTTCCGATGGCTCTGAGAATCGACGAAATCACGAACTCAGATCCGCAGCAGGTGTCGTCGTCGTCGTCGGAGGTTTATAACAGAATTTCAAATTCGGTCAGAAATGAGTCGCGGCGTTCGAATCGACCTGTGAAGTAGGTCGGTCGGTCGGACGGATGACGACCTCGATCCTATGCATGTGCCCGCAAGTGTATGATCGAGACTTGCCAAGCAGGAATAATCTGGCCATCCAGAGCAGACCGACCAACCGACCTTCTGAGAAGGTTGGCTGTACGGGGACGTACACGTCGATCTCAGAAGGAGAGAAATCGAGCTCGGATCTATTTCCCGTGCTGATCATGACCAGCCGCCCATCATCATGGGCTTGCTGCTCGGGGTCGGGGTCGAGGTCAGGGTCTAGATACATGGCCAATCGGGGCCAAATGATGAGTGGCGACTAACGCGAGAGTTGTCGTACATGCAGGAATATCATCGTGCATATCGATTTGGTAGTCCTGTCGTCCACGGAAGTGCTACCGCCAGCAGCAGCAGCAGCAGCAAGAGCACGAGCACGAGCACGAGTCTTACGACGGTGGACATGAACCAAGTCCAATACGGGTCGGGGGTGAATGGGGGCCGGGCGTGGGGCTTCCAACTGCTGCACAAAAATCCGGCGGGGCCCAATCCCATAGGCAACGAGTTCCGGCCGGGCAACAGCAAGACGGTGGCCAAGAAGAATCGCTACCCTCCGCCATACGGTGGCTGA

mRNA

>Mapoly1011s0001.1
ATGGGTGCCTTGACTTTGCGGATGCTCTTGGTTTTAACATTGGCGGTTATGACAGAATGCGGTCGTCCTCTTCAGAGTTCGCATATGAGCTCATTGGTCATGTCCATGCTCCAGACTCCACCGAAACCACTGCAGCCGCCTCCTCTATCTCCTATACAGCGCGAACAGATGCTTCAGGCTCGCAAGCCCCCGTCTCCGACAGCTGAGGAATATCATCGTGCATATCGATTTGGTAGTCCTGTCGTCCACGGAAGTGCTACCGCCAGCAGCAGCAGCAGCAGCAAGAGCACGAGCACGAGCACGAGTCTTACGACGGTGGACATGAACCAAGTCCAATACGGGTCGGGGGTGAATGGGGGCCGGGCGTGGGGCTTCCAACTGCTGCACAAAAATCCGGCGGGGCCCAATCCCATAGGCAACGAGTTCCGGCCGGGCAACAGCAAGACGGTGGCCAAGAAGAATCGCTACCCTCCGCCATACGGTGGCTGA

CDS

>Mapoly1011s0001.1
ATGGGTGCCTTGACTTTGCGGATGCTCTTGGTTTTAACATTGGCGGTTATGACAGAATGCGGTCGTCCTCTTCAGAGTTCGCATATGAGCTCATTGGTCATGTCCATGCTCCAGACTCCACCGAAACCACTGCAGCCGCCTCCTCTATCTCCTATACAGCGCGAACAGATGCTTCAGGCTCGCAAGCCCCCGTCTCCGACAGCTGAGGAATATCATCGTGCATATCGATTTGGTAGTCCTGTCGTCCACGGAAGTGCTACCGCCAGCAGCAGCAGCAGCAGCAAGAGCACGAGCACGAGCACGAGTCTTACGACGGTGGACATGAACCAAGTCCAATACGGGTCGGGGGTGAATGGGGGCCGGGCGTGGGGCTTCCAACTGCTGCACAAAAATCCGGCGGGGCCCAATCCCATAGGCAACGAGTTCCGGCCGGGCAACAGCAAGACGGTGGCCAAGAAGAATCGCTACCCTCCGCCATACGGTGGCTGA

Protein

>Mapoly1011s0001.1
MGALTLRMLLVLTLAVMTECGRPLQSSHMSSLVMSMLQTPPKPLQPPPLSPIQREQMLQARKPPSPTAEEYHRAYRFGSPVVHGSATASSSSSSKSTSTSTSLTTVDMNQVQYGSGVNGGRAWGFQLLHKNPAGPNPIGNEFRPGNSKTVAKKNRYPPPYGG

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>