Mapoly3661s0001



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_177475
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED
PANTHER PTHR31301:SF6

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD22 transcription factor, ASL/LBD Mapoly3661s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly3661s0001.1 scaffold_3661:991..1740  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly3661s0001.1  

Gene structure:

mRNA scaffold_3661:991..1740  ( + strand )
CDS scaffold_3661:991..1000  ( + strand )
CDS scaffold_3661:1526..1740  ( + strand )

Sequences:

Gene

>Mapoly3661s0001.1
ATGGCTGGAGGTATGTAAGTAAGCATTGTCTGTGGTCCGAGATTAGTTCTCTTCACGCGTGCCAGATTTATCGGTTATAATTTCTAACGCTGTAACAACGTGCACTACGAGGGAGCCGCCAGCAGATGTGAATACGCTCGCTCGGCTCGCAAACGACCGGATCTGAAAATAGAGAATTCCCTTGCAAAATGAGATGACAAATATTTGAGTTTGGAATTCTAGCTCGGAGGTGTTGGTGATCCCGTTACGAAGGATCCATGTCCGAGACTTGGGTCGGGGCACAGCAGGTACCAATATGGTATCGCAGATTTCAGATCTATAGGACACAAGTCTTACCATGTTCCACTTATGCTCGACTCGCAGACGAGGTTTTACGTCGATGGGATTCCGATGGAACCCAAGGAAGGACAGAGATGTAATGGCTTTCGTTGCGGAGCCTGTAAATTCTTTCACACGAAGTGCACGGACGATTGCCCATTTGCGCCATCTGTACTTTCCTGCAGAGTATCCTCTTCAAGTTTCTAAATGTCCACAGAGTCTTTGGGGGAAAAATATGTCAGCAAGATGTTGCGGGACTTGCCGGAGTCGAGCCTAGCGGATGCAGTAAGGTCGTTGTATTTCGAGGCCGAGGCAAGGATTAAGGATCAGGTTCACGGATGCTCCGGCGAACTTTACAGAATCCAGAAGGATTCTGTAAAGGAGCTCCAAGCAGAGATTTTGGAGGAGAAGATTGTCATGAGACCAAATTAG

mRNA

>Mapoly3661s0001.1
ATGGCTGGAGAGTCTTTGGGGGAAAAATATGTCAGCAAGATGTTGCGGGACTTGCCGGAGTCGAGCCTAGCGGATGCAGTAAGGTCGTTGTATTTCGAGGCCGAGGCAAGGATTAAGGATCAGGTTCACGGATGCTCCGGCGAACTTTACAGAATCCAGAAGGATTCTGTAAAGGAGCTCCAAGCAGAGATTTTGGAGGAGAAGATTGTCATGAGACCAAATTAG

CDS

>Mapoly3661s0001.1
ATGGCTGGAGAGTCTTTGGGGGAAAAATATGTCAGCAAGATGTTGCGGGACTTGCCGGAGTCGAGCCTAGCGGATGCAGTAAGGTCGTTGTATTTCGAGGCCGAGGCAAGGATTAAGGATCAGGTTCACGGATGCTCCGGCGAACTTTACAGAATCCAGAAGGATTCTGTAAAGGAGCTCCAAGCAGAGATTTTGGAGGAGAAGATTGTCATGAGACCAAATTAG

Protein

>Mapoly3661s0001.1
MAGESLGEKYVSKMLRDLPESSLADAVRSLYFEAEARIKDQVHGCSGELYRIQKDSVKELQAEILEEKIVMRPN

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>