MapolyY_B0017



Description

GAGA binding protein-like family

Reference DB

Database ID Description
OrthoMCL OG5_170179
PFAM PF06217 GAGA binding protein-like family
PANTHER PTHR31421 FAMILY NOT NAMED
PANTHER PTHR31421:SF1

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBPC2 transcription factor, BBR/BPC Public

Transcript models

Transcript ID Location Sequences Gene model
MapolyY_B0017.1 Chr_Y_B:769137..771773  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

MapolyY_B0017.1  

Gene structure:

mRNA Chr_Y_B:769137..771773  ( - strand )
three_prime_UTR Chr_Y_B:769137..769710  ( - strand )
three_prime_UTR Chr_Y_B:769946..769984  ( - strand )
CDS Chr_Y_B:769985..770843  ( - strand )
CDS Chr_Y_B:771170..771183  ( - strand )
five_prime_UTR Chr_Y_B:771184..771323  ( - strand )
five_prime_UTR Chr_Y_B:771546..771773  ( - strand )

Sequences:

Gene

>MapolyY_B0017.1
TCTATATACTTTACCTAAACACGGTTGTTGCTCGTTAGTGACTAGAAACTCGAGATTAATAGTCGCTTCCAGTACGACACTGTTTTCAATCCAGCACCGGTCCGTTTTGTTTACATCGTTACACCGGGATCCGGTATTCGGATATATGCCTGTAACCTCTTAGGCCCTGAGTACATGGTAGCAACGCGAAATTTGTAGACGCCCTCCGATTGCTGTGCCTCAAGATATGTATGTTATTTGGCCAACGAAGATTTCTCGATTTGACGAGTTCATCTTTTGTGGCTGCAATGCATTTTTATCTTATCAGAGTTGGTCGGGCTCAAGTCAGATAGTTCTGTGACCTTGCGAGAGTTCAAGGTTTACTCCATAGTTTTCAGTTTACTGTGACTCTGTTTGTTTGCTGTCAGTCGGTACAACGGATTGACGCTCCTCCTCTCTGTGGTTGATCAGGTTGATGTTGCTTCTGAATTTCTTTTGAGTTTCGTGAGAGGCAGTATCAATCAGACCCAGTGTATTCTCTCTGTTTCTGAGAAGAAAACTCAAGAGTACTGAAGGGCACGATTGGTAGTCGAGAAGCACTTCTTTGCACCATGCAATTGTCTATGTACGATCCACGAAGCTCACATCAAGTCTATTTTTATCTGTTCAAAACTAATTTCTGAAGATACGTTTTGCCCTCATGAGTTAAGAGGCAATGTTTGACTTCTGCGTTGCTGCCGAGCTCTATCATCAGTCGAGAAACAGACCGTCACAAAATTAGCATCACAATTCATGTTGAAGTGCTGGGTTTCTAGGTTCTGAGAAATAGTGGTGCAATGTTTTGCGTATTCGCTGTCGAATAGGGTTGCCTTAGTATAGTGTGTCCTGGAACTTTTTGATGTTGTAGCTGTGTGGATGGGAATGTGAGGGGAGAGGCGGGATGTTTTGCAGGCATCATACGGACGCCGCCGTCCGGAAATTGATAACAATGATTGCCGAAAGGGATGCGGCTATTCTGGAGAGAAATTCAGCTATTGCAGAAAAAGTCGCCGCTCGTGAAGAACGAGACACTGCACTGCTCCAACGTGATATGGCCTATGCAGACCGGGACTCTGCCATCGAGGAGAGGGACGCAGCAGTTGCGGCTCTTGAAATAGCAATGACTGACCGAAATATTTTGGAGAAGAGAGTCGCAACGAAAGATTCCAAGTTATTTCAGTCATTCAGTATGACCAAGAATTGTACGCTTTTGGGAGCTATTCAGCCGTCCTCTCTTTCAACATCACGATTCAGTTCTATTGTTGCTGAGCAAAGCGACCTGTGCAGAAACGGAAGTTCCAAAGAAGATCAGGTTGGTTTGTCGAGGAAAAGGAAGATTGTTGTGAAATCAACCCTAGATCGAACTTTACGAACAAAAAGATCTTACCTTTCTGCCAATGAAGAGCGAGGGCACGAGATAGGTGATGGGGAGGAAACTGATCACTACGCTCGGTCAAAGGAGGAAATATATGTGGAGAATGTACGTTATCCTATACCACATTGTTCATGTACAGGTGTGAAGCAGCAGTGTTACAGGTGGGGCAATGGAGGCTGGCAGTCCTCTTGCTGCACTACTATGATCTCCATGTACCCGCTGCCGATGAATCCAACCAAAAGGGGATCAAGGTTGGCTGGTCGCAAAATGAGTGCCGGTGCTTTTGAGAAGCTCCTGGAGAAGCTTGCTTTGGAAGGGGTCAACGTGAACTATCCTGTCGATCTGAAGGATCACTGGGCAAAGCATGGAACAAATCGCTATGTCACTCTCAGATGAAAAAGTGTGAGACCCTAGCAGCTTTCATCGAACTAAAAGGTACGCATCAACACGTTCGACGTTGCAACGTTTAGAGTTTGCAGTAGTATAGGTCATAAGCTTAAACTTTTCACTGCCTAAGTTGTGGTTTTTCTTAAAATTTAGAATTTTTTGCCTGGAGTATGCTTTTATATTTATTTAAGCACTTGGGTAATTAGTGAATGTGCCTTTACTTGAACCTCAAGTTAGTTCATGCCAGCCGGCTTGACTTCTACGAATGTTTTGAATGTACCAGATTGGTTCCACAACAAGGGAAAAGCATTATGATCAGCATGCTGCCCGTACTTCCGCTTTTGCATGAGGAGGATGGAATTAAAACCACTTGAGAAGCATTCTTCATTGACTAGTTGTTGTTGCAATTGAAATTGTGGGAGTGGGGATATTTCAGCACACTTCAGCAATCCTAGAGAGCAGCCTAACTGTGGTAAAAAAACAGCAATTACAACAAACTGTGACTCTCAGTTTTTTGTTTGAGCCGCCCCAATTTGGAACTTTTGAAATGTTGCTCTTTGGCTCTTGTACAATACATTTTTAAACTTCTTTATGTCTTGGGCCCAGCGAGGTCATCCTTTGACATTCAATTCCTCTAATCGTACAATGCTCTTGAAGATATTAGGGTGTAGTTTTAAAGTTTTACATGAAATTTGTTTGAAGTGTTCGTAGTTACCTTTGCCCAGTTGTACAAGATATGACCGGCATTCACGAATGAGTACAGTATGATGTTTAAGTATTGGCATTACTTGTTAGTGCAACAGCTGATTTGCGGGTGAAGAATTGTTGCGTTTTTGTTTAATTTTTATCTTCGCCTG

mRNA

>MapolyY_B0017.1
TCTATATACTTTACCTAAACACGGTTGTTGCTCGTTAGTGACTAGAAACTCGAGATTAATAGTCGCTTCCAGTACGACACTGTTTTCAATCCAGCACCGGTCCGTTTTGTTTACATCGTTACACCGGGATCCGGTATTCGGATATATGCCTGTAACCTCTTAGGCCCTGAGTACATGGTAGCAACGCGAAATTTGTAGACGCCCTCCGATTGCTGTGCCTCAAGATATGTTGATGTTGCTTCTGAATTTCTTTTGAGTTTCGTGAGAGGCAGTATCAATCAGACCCAGTGTATTCTCTCTGTTTCTGAGAAGAAAACTCAAGAGTACTGAAGGGCACGATTGGTAGTCGAGAAGCACTTCTTTGCACCATGCAATTGTCTATGCATCATACGGACGCCGCCGTCCGGAAATTGATAACAATGATTGCCGAAAGGGATGCGGCTATTCTGGAGAGAAATTCAGCTATTGCAGAAAAAGTCGCCGCTCGTGAAGAACGAGACACTGCACTGCTCCAACGTGATATGGCCTATGCAGACCGGGACTCTGCCATCGAGGAGAGGGACGCAGCAGTTGCGGCTCTTGAAATAGCAATGACTGACCGAAATATTTTGGAGAAGAGAGTCGCAACGAAAGATTCCAAGTTATTTCAGTCATTCAGTATGACCAAGAATTGTACGCTTTTGGGAGCTATTCAGCCGTCCTCTCTTTCAACATCACGATTCAGTTCTATTGTTGCTGAGCAAAGCGACCTGTGCAGAAACGGAAGTTCCAAAGAAGATCAGGTTGGTTTGTCGAGGAAAAGGAAGATTGTTGTGAAATCAACCCTAGATCGAACTTTACGAACAAAAAGATCTTACCTTTCTGCCAATGAAGAGCGAGGGCACGAGATAGGTGATGGGGAGGAAACTGATCACTACGCTCGGTCAAAGGAGGAAATATATGTGGAGAATGTACGTTATCCTATACCACATTGTTCATGTACAGGTGTGAAGCAGCAGTGTTACAGGTGGGGCAATGGAGGCTGGCAGTCCTCTTGCTGCACTACTATGATCTCCATGTACCCGCTGCCGATGAATCCAACCAAAAGGGGATCAAGGTTGGCTGGTCGCAAAATGAGTGCCGGTGCTTTTGAGAAGCTCCTGGAGAAGCTTGCTTTGGAAGGGGTCAACGTGAACTATCCTGTCGATCTGAAGGATCACTGGGCAAAGCATGGAACAAATCGCTATGTCACTCTCAGATGAAAAAGTGTGAGACCCTAGCAGCTTTCATCGAACTAAAAGATTGGTTCCACAACAAGGGAAAAGCATTATGATCAGCATGCTGCCCGTACTTCCGCTTTTGCATGAGGAGGATGGAATTAAAACCACTTGAGAAGCATTCTTCATTGACTAGTTGTTGTTGCAATTGAAATTGTGGGAGTGGGGATATTTCAGCACACTTCAGCAATCCTAGAGAGCAGCCTAACTGTGGTAAAAAAACAGCAATTACAACAAACTGTGACTCTCAGTTTTTTGTTTGAGCCGCCCCAATTTGGAACTTTTGAAATGTTGCTCTTTGGCTCTTGTACAATACATTTTTAAACTTCTTTATGTCTTGGGCCCAGCGAGGTCATCCTTTGACATTCAATTCCTCTAATCGTACAATGCTCTTGAAGATATTAGGGTGTAGTTTTAAAGTTTTACATGAAATTTGTTTGAAGTGTTCGTAGTTACCTTTGCCCAGTTGTACAAGATATGACCGGCATTCACGAATGAGTACAGTATGATGTTTAAGTATTGGCATTACTTGTTAGTGCAACAGCTGATTTGCGGGTGAAGAATTGTTGCGTTTTTGTTTAATTTTTATCTTCGCCTG

CDS

>MapolyY_B0017.1
ATGCAATTGTCTATGCATCATACGGACGCCGCCGTCCGGAAATTGATAACAATGATTGCCGAAAGGGATGCGGCTATTCTGGAGAGAAATTCAGCTATTGCAGAAAAAGTCGCCGCTCGTGAAGAACGAGACACTGCACTGCTCCAACGTGATATGGCCTATGCAGACCGGGACTCTGCCATCGAGGAGAGGGACGCAGCAGTTGCGGCTCTTGAAATAGCAATGACTGACCGAAATATTTTGGAGAAGAGAGTCGCAACGAAAGATTCCAAGTTATTTCAGTCATTCAGTATGACCAAGAATTGTACGCTTTTGGGAGCTATTCAGCCGTCCTCTCTTTCAACATCACGATTCAGTTCTATTGTTGCTGAGCAAAGCGACCTGTGCAGAAACGGAAGTTCCAAAGAAGATCAGGTTGGTTTGTCGAGGAAAAGGAAGATTGTTGTGAAATCAACCCTAGATCGAACTTTACGAACAAAAAGATCTTACCTTTCTGCCAATGAAGAGCGAGGGCACGAGATAGGTGATGGGGAGGAAACTGATCACTACGCTCGGTCAAAGGAGGAAATATATGTGGAGAATGTACGTTATCCTATACCACATTGTTCATGTACAGGTGTGAAGCAGCAGTGTTACAGGTGGGGCAATGGAGGCTGGCAGTCCTCTTGCTGCACTACTATGATCTCCATGTACCCGCTGCCGATGAATCCAACCAAAAGGGGATCAAGGTTGGCTGGTCGCAAAATGAGTGCCGGTGCTTTTGAGAAGCTCCTGGAGAAGCTTGCTTTGGAAGGGGTCAACGTGAACTATCCTGTCGATCTGAAGGATCACTGGGCAAAGCATGGAACAAATCGCTATGTCACTCTCAGATGA

Protein

>MapolyY_B0017.1
MQLSMHHTDAAVRKLITMIAERDAAILERNSAIAEKVAAREERDTALLQRDMAYADRDSAIEERDAAVAALEIAMTDRNILEKRVATKDSKLFQSFSMTKNCTLLGAIQPSSLSTSRFSSIVAEQSDLCRNGSSKEDQVGLSRKRKIVVKSTLDRTLRTKRSYLSANEERGHEIGDGEETDHYARSKEEIYVENVRYPIPHCSCTGVKQQCYRWGNGGWQSSCCTTMISMYPLPMNPTKRGSRLAGRKMSAGAFEKLLEKLALEGVNVNYPVDLKDHWAKHGTNRYVTLR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>