MapolyY_B0018



Description

transcription factor MYC2

Reference DB

Database ID Description
GO GO:0046983 Protein dimerization activity
KEGGORTH K13422 Transcription factor MYC2
OrthoMCL OG5_149804
PFAM PF00010 Helix-loop-helix DNA-binding domain
PFAM PF14215 BHLH-MYC and R2R3-MYB transcription factors N-terminal
PANTHER PTHR11514 MYC
PANTHER PTHR11514:SF28

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH46 transcription factor, bHLH Public
MpMYCY MYC transcription factor Public

Transcript models

Transcript ID Location Sequences Gene model
MapolyY_B0018.1 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.2 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.3 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.4 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.5 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.6 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.7 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.8 Chr_Y_B:778956..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.9 Chr_Y_B:779119..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.10 Chr_Y_B:779119..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.11 Chr_Y_B:779119..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.12 Chr_Y_B:779119..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.13 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.14 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.15 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.16 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.17 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.18 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.19 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.20 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.21 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.22 Chr_Y_B:781549..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.23 Chr_Y_B:784203..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.24 Chr_Y_B:797450..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
MapolyY_B0018.25 Chr_Y_B:797450..812221  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

MapolyY_B0018.1  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.1
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.1
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.1
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.1
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.2  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.2
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.2
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.2
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.2
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.3  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.3
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.3
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.3
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.3
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.4  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:808342..808395  ( + strand )
three_prime_UTR Chr_Y_B:808396..808527  ( + strand )
three_prime_UTR Chr_Y_B:811461..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.4
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.4
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.4
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGA

Protein

>MapolyY_B0018.4
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKTSQAHGIHEDSQSGECD

MapolyY_B0018.5  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.5
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.5
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.5
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGA

Protein

>MapolyY_B0018.5
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKDRILFYSSSNPYECEECADKGATPWCH

MapolyY_B0018.6  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:808342..808395  ( + strand )
three_prime_UTR Chr_Y_B:808396..808527  ( + strand )
three_prime_UTR Chr_Y_B:811461..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.6
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.6
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.6
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGA

Protein

>MapolyY_B0018.6
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKTSQAHGIHEDSQSGECD

MapolyY_B0018.7  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.7
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.7
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.7
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGA

Protein

>MapolyY_B0018.7
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKDRILFYSSSNPYECEECADKGATPWCH

MapolyY_B0018.8  

Gene structure:

mRNA Chr_Y_B:778956..812221  ( + strand )
CDS Chr_Y_B:778956..779080  ( + strand )
CDS Chr_Y_B:779268..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.8
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGTAAGTTCTGCTCATTCGTCACAAAGTTTACATGACATATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.8
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.8
ATGCTAACAGGAAAGGATTACATGCTCGGAGCTGCTTCAGGACAGTTCATGGATGTGAGGTATGCCACTGTTTCATTATTAAGTTTTCTATTCCTGAATCATATCAACGCAAATTACTTCTGTATGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.8
MLTGKDYMLGAASGQFMDVRYATVSLLSFLFLNHINANYFCMSNLVEKFQIASCFGPRCLMGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.9  

Gene structure:

mRNA Chr_Y_B:779119..812221  ( + strand )
five_prime_UTR Chr_Y_B:779119..779322  ( + strand )
CDS Chr_Y_B:779323..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.9
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.9
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.9
ATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.9
MGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.10  

Gene structure:

mRNA Chr_Y_B:779119..812221  ( + strand )
five_prime_UTR Chr_Y_B:779119..779322  ( + strand )
CDS Chr_Y_B:779323..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.10
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.10
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.10
ATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGA

Protein

>MapolyY_B0018.10
MGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKDRILFYSSSNPYECEECADKGATPWCH

MapolyY_B0018.11  

Gene structure:

mRNA Chr_Y_B:779119..812221  ( + strand )
five_prime_UTR Chr_Y_B:779119..779322  ( + strand )
CDS Chr_Y_B:779323..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.11
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.11
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.11
ATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGA

Protein

>MapolyY_B0018.11
MGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKDRILFYSSSNPYECEECADKGATPWCH

MapolyY_B0018.12  

Gene structure:

mRNA Chr_Y_B:779119..812221  ( + strand )
five_prime_UTR Chr_Y_B:779119..779322  ( + strand )
CDS Chr_Y_B:779323..779564  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.12
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGTAAGCTGTGAAATTCTTCTCAGTGTACGGGATTTTTATGGTGTAGTTGTGCATACACTTTTTCAATCTTATTGCGTGGGCGTCAAATTGCTGAAGTTTAGTTCGCACAATCCGTCTCACACTACATGTACGTCAAGGTCAACGTTCAGTGCGCTGCAAATTGCTTCCAAGACTAGCGGTAGAGTAATAATGGGTGTTCACAAGTTTTTAAGAAGAAGGTGCACGCATAAACTTACACCCGAGTGGAGAATTGAACAGTTCGAAAGTTCGAGACCATGAAAGGGTTCTGTGTGAGACGTATTAAAATCACTGTACTGTGACTCCTCGATGAAAGGGATTCTCTCGACGAATTCTATCTCATATACATCTCCCTAACGTATCCCTAGTTTCATTCCATTCATGCTTCGCTTTGGGCTATTCAAAGATATTAACTTATAGTCAGCTTGGTACCAGTAATCAAATCCTTTACCTTGAAGATCATCGGGACACCGTTACAGAAAGATACAGTAATACTTCATTTCTACTTCTTGACTCTTAAGTATTTTGTACAGAGTTTTCAGTTGTGGTTATGATCTTCTTGTATAATTTTTTAGGTGCTTTGCTCTCTGTGTTAGATAGACTTTCATCATCAGGAAATGAACTTTTTTCAGTTTTTTTTGATCTGGAGATACCGCTGAAGAGTCTGATTTCAACAGTGCAAATATATACCTTGAAGTTTAAAGTAATACATTAAGCAGATTAGTGTTCAAGCTCGCACATCCTTCTCTGGCAACTGGAGATGGACAGTTTTGTACCCTTCAGTTGTTAAATCATTTAAACTACATCAATAACGCTTTAGAATGTTACTGCTGCTCGATTTACTTCACAGTAAAGTTCAGTTTTATAGTTCAGCGCTGCACTCGTTGTTGTTGGACTGTTTGCATTCTGCCTAAGGTTTCGAGCTTTTATTATTATAAGTTTCGCTTTTTGTAGCGATCTCATTCACTTCATTGTCTGTTTTAGCTTTATAAATGTAGTCTTAATTCGCCTTGCTAAATATATATGGACGGGAGCGGATTGATACACGCTCCCGTCTTTTGCTTCTTCTTATTCCATATTGCCTGATATTAAAATTTACCTTACTTCCGATTCCCTGATGCATTTCGACGTCAGTTACCGGGTCCCCATAAGCTGGATCTAAATTCCACCGTCACGCTGGAATTTAGATAACTGCCGTATTTTTCTACCGTTCTTCTGGTCCTTCGCTCCTACCGCTTACGCTTCCATTTGTCTCTCATTCACTTACTGATTCACTTCGTGATGATAGAAAATTCGAGACAGGTCCCGGTTTTCCTATTATCGTCTTCCTGTGTCTTTCGAATCACTATAAAACGCTAGCGCTTCGCTTCCCTTCTCTTCCTCAAAACTTCACGCTTTCGATCAATTGCCTCCGTCCTCCATCTCGTTATTCAACCTCCGTCGTCTATTCATAGTCGTCCAACGCTTACATGCCTGCGGGATTTATGTTGGTTGCTAGTCTACTTGGGTTCTGTTGGATCTTTTGCTTCCACACGTAATTTTGGTTTTTTTGCTCGTGGACTTGATCAGATGCTTTTTCTTAGAGTTTCCTTCATGTGAGATCTCATCTCTTCCTGCATAAGATCATTATCCCTCTTTTATTTTCTCTTTGTACGCTATGTTCACCTAGACATAATTGTTCTGAAGGAAAAGTATTTTTGATGTGTACTTGAGTGACCCGAGGAGAAAATCTACTGTACTAGGTTGGATCTTAATGTTGAAAATACTTGCCAAATGGTAGATATATTATTACTCCTTTGCGTGAAACCGCTAAGAGAAGTCCCCAGTTGCACATTCCTTTACATATCCGTTGACAGGCATATGTTTATATTAAATACACGCTATTCGGGCAGCAAGAGAGCAGAAAGGGCTAAGGCTAGGCTTCTCAATAGGCGAGACATATGATGTTCTCGATGCAATGCCGATGCTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.12
ATTTGGGCACAATCTTCAACAGGTCGTAAATACACGTCTAGCGAAACAGGTTGTGCTCTGAAGGATTGTATGCGCTTCTACGGCGATTTGTAGTTCGTTCAGAGTATGGGAGCTTGTTACTAAACTTGAATCGTGTCTGTGTGACATAGGAGTAATCTAGTTGAAAAGTTTCAAATCGCGAGCTGTTTTGGTCCTCGCTGTTTGATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.12
ATGGGCACTGATGGAGGTCTCAAAGCTGCTTGGGACGAGGATAATGCAATGATAGAGGCCTTCGTTGGATCCGGTTCTTTCGATCTTCCATTCGTGCCGCCGGATGATGTTTTGGGTGGAAGAGGGCTTCCAATTAGCGAGACGGCACTTCAGCAAAGATTGCAACTTTTGGTGGAAGGGACCTCTCTGAATTGGACGTATGCTATATTTTGGCAACTATCGTATTATCCCAACGGAGAAATGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.12
MGTDGGLKAAWDEDNAMIEAFVGSGSFDLPFVPPDDVLGGRGLPISETALQQRLQLLVEGTSLNWTYAIFWQLSYYPNGEMVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.13  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.13
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.13
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.13
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.13
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.14  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.14
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.14
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.14
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.14
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.15  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.15
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.15
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.15
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGA

Protein

>MapolyY_B0018.15
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKDRILFYSSSNPYECEECADKGATPWCH

MapolyY_B0018.16  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:808342..808395  ( + strand )
three_prime_UTR Chr_Y_B:808396..808527  ( + strand )
three_prime_UTR Chr_Y_B:811461..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.16
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.16
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.16
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGA

Protein

>MapolyY_B0018.16
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKTSQAHGIHEDSQSGECD

MapolyY_B0018.17  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:808342..808395  ( + strand )
three_prime_UTR Chr_Y_B:808396..808527  ( + strand )
three_prime_UTR Chr_Y_B:811461..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.17
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.17
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.17
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGA

Protein

>MapolyY_B0018.17
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKTSQAHGIHEDSQSGECD

MapolyY_B0018.18  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.18
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.18
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.18
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGA

Protein

>MapolyY_B0018.18
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKDRILFYSSSNPYECEECADKGATPWCH

MapolyY_B0018.19  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.19
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.19
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.19
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.19
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.20  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782302  ( + strand )
CDS Chr_Y_B:782303..782427  ( + strand )
CDS Chr_Y_B:782635..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797594..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:811461..811619  ( + strand )
three_prime_UTR Chr_Y_B:811620..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.20
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGGTACAGAACTGTACTGAAATGAGACCAACTAAGAAATTAGTAGAAATAAGCACTTCCACCAGATGATCACCGAGTGTCTAATCTGACTCTCAGCTTCTTGATATGAAAACAATATACCAGAAAAGTGGTATGAGAGAGTGTTTTTGGCTAAAACTTGAACCTCATGAACATCCATAAGCTAACTCTAATGTAGCCCTAATGTAGAGATATTGACAAACCTTAAATCAGTAATTTCTAATTGATAAGTTAGAATTAAGTTTTACAGAAGAAACTTTCCATTGAAATCAACAGTATCCTCATATTTTACTAGGTCGAAAAGGGTAATTAAGACTTCTTCATGACTCTCTGCTCTATGCAAAATTTTTATGGATTCATCAATCTGTAAGTTTTCAATCTCAAATGTGGCTAAGTCTCCATACACAAGTTATATCTGGGGAAAGACGTTTGTCTAATTTTTTTTTTTTCAAGATGCAAGACTAATTATTATTATCATCATTCGAAGCAAGGAAGTAAACAAACAAGAGATTGCATGGTCGTACCAACTATCAATGTCATAAAACTGCTATCTCCGGGACATCTTTCTCTCTGCTGTCTTTCTACATTTATCATCAATAGATGCAAGAATATACTCAAACCGTCCTGAAGGAAGAAACTTTATGGTCCTGTTAATGATAAATGCCGTGTAGGTGTTAACCCTTGAACACCTTCCCATCTGCGGCTTTACTACGTTGTCCCTGAGAGAGGTTAAGGAATAATAAAATCCCCTCATAGAGATTGCATGTGCTTAGCATTCACTAATGTTCTTAAGGTCTCTAATCTTGAAGATCTTTCCCTCTGGGCATAGGTCGTGTTGAGGAGCAGGCCCGCCCCATGAGTCATATTCTTGGAGCAGGCTAAGTCCATGTACACAACGGTGTTCACAAGAGAGCCTTCGTTCAAATTGGGTTGTCTTTCAAACTATAAGGGAGCGTTGAAGTACATAGCAAATTTACTTCAACCAGATTTCACATTTTTCCCCAAGATGTATCCCCAGGACTAGACGCGTTCTGCCTATACTGACGTTGATTTACAGTTGGAGAATGCAGTACTGCAATATGCGCACAATCTTTCCTTTGTTAGGTTATGTCCTCAGAATGATGATGTTCGTTATATGTTTCCCAGCTATGGGCATCTACCAAACAGTGCGACAGTGAACATACCATTAGCGGGTAGCTCTATAATAAGCCCGCTGTCTAGGTCATAGGCGACCTTTACTTGAGTATTTCCTCTCTATTGACTCCTTGGTCTTAACTTTCAGAACTCTCTCCAAGGCTATGTATAATGTTCCAAAATTCTGGATGCTGTCAATGTTTCATATGTTCTAGCTAACCTGGTGCTTTTCTATATATCTACAACAGATATGGAAACACTTCATGGTCTGTTAAGAATGTGAGTTTTCCTCAACCCCTGTCAGTAAGTAGTATATAAGTTCTACTGTAGTCACGTCTTAGACAATTAAATGTCCGTATCTGTTACAATTGCTATTGTTTGTTCTCACATCCCCTCAATACTTAGCAGCATGTAAGTTTTTACATCCAAAATCTCATAGATTCCAAAATTTTACGTATGTATTACTTTTATGCAATTTTGAAATTCAATAAACACTCTCGATACATTTTTCATCTGGATCTAGAATGTATCGAGATCCAGATGGATGGCCCGTAGCCGCTCCAACTCGAAATCACCTGCATCCGTATACTAAAAGGCTGATTGAGGTTGGAAAACGTTAATATCAATAAATATTAACATCCTTTCTGGCATTTCTGCAGCAGCTCGCGCACATCATTGACAGGTCTTTGTAATTGCAAAACTCAATTTCAAATTGTCCAAAGGAAGGAAAGCTTGCAAGATGTTCAAGAATTTATTAAAACGAGTCTCTCCTTTAGTTTCCGCAAACATCTAGCCTCCTGGATTCACAAAAACTCTTCTTCAACTATTTGTTCCATCTCGGTTCCATTTCCTTCAGCTCTTTGCTTTACTGTTCTCAGAGTTGTTTGCTCAACATTTGTAACAACTTGTAAGTATGTCGACTCGCCCATTAGAATTCTGATTTGATCACAGCCACCGGACATCTGTCTGGCACCAACAGAGTCCAACCTATGTTATCCTTGTCTAGTTACGAACTTCGTAACATCGACCTCTAAAGTTGTTCCAGTCTGTCAAAAACTACCAAGGTTCCCATGACTGTTAATTCGACGGCCGATCTCCTCCCTGTATCCCACCGTTTTGCTTCTTCGAGTTGTTTCTTACTGATGCATATGTTTGTCTTTTTTTAATTTACAATTCAGTTCATGCATAGCACGTCCCACTTTTACTGGCATTCTCTTCTTGTAAATTAGATTATGTTTACTTTTTCCATCAGCACATCTAGATTTGTGTTCCTTAGGTCTCTTGCATGGTAAGTTTTTGCGGCTGATCATGTACTATTCTATCTGTCTAACCTCTTTAGAAAGGACTTGGAATGCTTCTGCTGCTTGAACTTCACACACTAAATTTGATTGCTTTTGCTGACCGTTGCGTTGACCTTTGATTGACTATATGCTCTTTGCCCTGGGTACTTTGCGTGCACCGCGCGCAGCTATAATACGCTTCATATTATGAGCATGCCTTCTACAATCAATCATATGCCTCCTACGGCTCGCACTGAATACTTTTACTCAGACTTGCTAGGTAATGCATCCTACAGATGTGCAATCATGAAGCGACGTCGAATGACCCTCTTATTTCGATAAAAATGGAATACACTTGACTATTGGAGCAATCTCAACTCTGCCTACATCTTCAAGCTTCAAAGCTACTATATCTGCTGACTGTAGTATAGAGTGAACGAAGATACCAAGGTTGCTTACATCTTTCTGATCGGTCCAGACATCCCAAGCACATGGAATACATGAGGACTCTCAATCGGGTGAATGTGACTGATGACATGTATTCCATGTCAAACTCAAAGTATCATAGTAATCAAGTATCATAGACGACAACATCGTCAGCAAAGCTGTACTCAATGTTGTCAAGAGGAGACTTAAACAGTTTCTCTATCTCCTCGACATCAAGGTGGCCACACGATCCAGTTCTTTACCCCATGATAGCATATTATCTTATGGTTCTGAAGAGTGCAGGATAGTAAAATATTTCATGTACTGACTGATTTCGTTTGTGTTGATCCTGAAGTTCTAGAGGACTGCCTTCATTAAGTGCTAGTAGCCACTTGAGTACTCCCCTCGCTCCAGGCAAGCCTCGATAAATTGCAGCTCCGTTTAAAGTCCTCTATGCAGCAGTCCTCGTACTTGGCGCAAAACCAACTCAATTACAACAAGAATCCTAATCCACCTCTTCCTCATCCACATGCATAGCTGATATCACTGTCTGAGCACTTGCTGAGTGTACTCTGTGAACTGATTTTCTTTTGGGAAGAGGGTCATACAGAGCTTTAAAGGTCAAGTTTGAGCTGTGCTGCAAAGACCCTGAACTGTGGGTGCTGGTGGTTGTCAGTCACATAGTAAGTCAGGATCTACGTGTAATTATCACTCAACCTTATTAAGATTGAAGATCACTGAGATAGCTGTGAGGTCTGAGGTGACAGGAAGCTAAATCACAACACATGATTCTATATGATGCTATTTATGTACTAAACTGCCTGTTCTTCAATGTTTGTAATTACTAACATTACCACACACTAGTTCCTGGGATGAATTATTCAGAAAGTTCACGAACCCATTTGATTGCCGTGTTCAGTTTAGTTTGATTTGTGCAGTTTAGTAAGTGCTTTTTGTCTATGCATCTCATCTTTCAGATACTTCTTCAGAACTTCAGGAATTAGTGCAATGCCTGGACACCGATAAGCTTTGACTCTTCCTTCGACCACCTGTATTATGGGTTTTCATTTCTGACCTGCGGGTTTACAATTCTCAAGGATTAGGTTATTTTCATTGCTTGTCTCAAGTCCTCATGTCCCAACTCAATTTTTTCCAACATGCATGACATCTTTCTTTATATTAAGCTCTTCACTTATTCTCGTAGTCTTGGTGTACTTCTTAAAAACTTAGCTTTTACAAGCGCCTACTGCAAATACTTTTAGACATCTAACACGTCGCCCACCACTTTGATTTTACACAATGCTACAAAGAGTTTGAACTTGTCAATTGTATCAGTCTCAGTAACTGTCAAGTTCATACCGGTAATAGGATACACTGAGTAATGGGATACATCACGCAGTGTATCAACTTTGTGGGTATTGTGGATATCATGCATATCACAATGCAGGAGGTCGATTGAGTCATTCCAAGCGAGGGAATTTGGGGCGATTGTCTTGTTTGCTTTACCTTGCCCAAAAACCTTACCAAATTCAGTTATGGTAATTTGCCCAACAATTTTCTTCTGTTTTCTTATACAAATTCATAAACATTCTGATGCAACGATTCTTCTCTTCTTATGATATATCATGAATTCTGTTGTAGGAACTGACTAGAACTCTAGATAATTTGCTAGTACCTGTTTTCTTTGGTGAAGCTATAGCTTGCTATCACTCCTCTTACTCTCAGATAGACAACACCAGAATTCTAAGTAGCTTTCGCTGATAGAAGACAAATTCGAATTCAACAGAATGATCACCGGCAAGGTGTGTCTTTTGACTCCTGAGTTATTTATAATCACATTAGCTCTTTATACAGACTTCATGAATCAAACGTAAGCCCCATGTTCTATCTCAAAAACCTTGTCTGGGTTATGGTGGCTGAACCTTACTTCAGTATTTGCTTACGTTACAAGTTGGAACCTGACTTTCTTCTTTCGCAGAAAGTCAAGTGACCAAAACAAATCCTTGTGTTACAGCTGTGATATAATTCTTGAACTAGAACGAGTTTGTCTTCTTGCTAGAAGAAGGAAGCACCTGCTCCGCCACAAAGGAGAGCTTTTTTGACTGATCGGCATTGGAGCCGTCTTCTCCAACAACGCATTCTTCAGGCGTCGAGTGATCATAATGTAGTGACCATAAACCCTAAGTAGTGATTTTTCTTCAATCTTTTCTGCGTCTTGTTCTTACATATCAATAGTGTGCAGTGTAACCCTCCCACCAATTACACCTTTTGATATTTTTCTTTGACAGAATACCTTCTTCAAGTATCCTGAATTTCACTAATGTATACTTCTCTTGGGGATTTACAACGGTTTAGGATTTACTCTACAGGTCATTGTCCTCATCACCCTGTTTGCTAGCCTTGTGAGCTTATGACTGAAGTTTGTCATCATCATACTTCTAGGTAAAGTTGACTTCATTTACTCCTACCAAGGCTGGCACAATGCCGTCCTATGCCTAAGGCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGAGGCACAAACTTATTGTTGGCTGATTACTAGTTGGTTGTTGATTTTGGTGCCTTCCTTTTTCCCATAATGGTTGTGGAGATTTTTTTCAAGATACAGACGGCCATATGAATCTGTCTGTTCCTAAGGTTTCACTTTTCGTCCGCTCAAATATTTTACACAAGAGTAAGTCAAGCTATGTGACAGCAGCGCAACCTTGTGGAGGGGCACAAACTCATTGTTGGCTGATTTTCAGTTGGTCGTTCTTTGATTTTGATGCCTGCCTTTCTCCTATAACTGTTGTGGAAATTTTCTTCTAGATACAGACGACCATATGAATCTGTCTGTTCTTAAGGCTTCACTCTTCGCTCAAATATTTTATACTAGAGTAAGTCGGATACTAATATTTTTCCTGTATACACTAATTGTGAAAACGGCGAGGAATCTAGTTCACTGCCCCAGTTTTGCGCGTTACTTCACATGGTTGACGGTTCAGGATTAAGCAAGCTAGTAGTATATCTGCTCATTGATAGGTCAATATAGGGTTCATCTGTCAGTAAAGATGTTTCATAGCTTGCGTCTCTTACTTTGCAGTTGTCTGGTTCTTGTAGAGAAGATGAGACTGAACTATTGTTTAATCTGTATGCGGTTGTGTTTCAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

mRNA

>MapolyY_B0018.20
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGAGAGTGAGCACCATGACTGCACTGATGTAGCTAGAAGCTCATCATGAGAGGAGACGATATTGTGCAGCTTTGTTATAAACTTAGCTTCAGCACTCAACGTTCATATCAAACAGTGTACACCCTCTAGAGTTTGGAAAGACGCCGATTGTATCTTGAATCAGTTCATTGGCGAAGTTTAAACAGTTTGAGGTGTCTCCATTGGTGTTGCAAGTGAGTGTCAGCGATCTCATGAATAAATTTTACTGCTAAAACATGGGAGGTGTACTCGTGAACTGATTCTCGTGTCAATAAATAACTACCCTTCCAGCATTGCAGTGTTAAAACCTTCACATGCAATGATACCTTCTCTTTGCAACCTTCGCATTTACAATCAACTACAAAATTATCTAAACTGATGTGATAAATCAGTGTGCAACAAGAATTCAGATTAAGTGCATCTTCGTAGACATCTCAGTCATTGAGAAGCTGGGTTCTTGGGTAAGTAAACACGATATCAGAGTAATATTTTCAGAGTCTGTAGAATGTATTTGGTTCAAAAGTGACCAAAGAGCCAATGCATATTTTTACTCGGACAAACATTATAAATGGTAATAGACCAAGCCC

CDS

>MapolyY_B0018.20
ATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGATGGCAGGTATACAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGATGAGTGTGAAGAATGTGCTGACAAGGGAGCAACTCCTTGGTGCCATTGAGAAGGCCTTTCAGAGTAACACAGTGGATTTGAAGGAGCAGGAGCAACTCTCTAAAGACAAAAGACCGACAATTTCACACTTCACAATCCAATGCCCCGATAAAGTGTGA

Protein

>MapolyY_B0018.20
MVQKARRFFGCTFHDVQYQILRAHLEEQRSIGGFIHLYLEQRVLGWGDGYFKGPKESENADPRGTEKDQTCREEDQLIRRKVLRELQALVCTGEDDTTASTGLDYVTDTEWFYLVSMSYFFSHGVGTPGQALASGEYVWLLEANKAPSHVCTRADLAKMAGIQTIACIPTKNGVVELGSTELIFESWEVINNIKEFFSEGIFEQSRRYQKPHLSSGKIGAMGCTHVTYPTGIDISNDVISNSCVKCNTFDKLNASSLPSNVDSLDYLFSDDASLVEIPLETDKNHMQPVGVPTLQSRLIIEEDKTAVFSKPLYLSLDQGRTAVSETGEILNPPEMTLNLRRSENQLQQKDSKFYLKKETMSVDSQSKDRAGESANHQVVDAKGVSLPSFVGRSSIESEQDVDSEAEVSYKDVVLVEQKPPRKRGRKPAHDREEPLNHVQAERQRREKLNQRFYALRSVVPNVSKMDKASLLGDAIAYIQELQQKLQIMELKCQSVPSSGRPSTSNHRGSRSHLDYSAQTGNTRSLHSYIYILDQKPNVDVELLGMEVMVRVNHLSEAYPTSQLMFALQDLQLEVQHANISTVEDRIFHLVIAKMSVKNVLTREQLLGAIEKAFQSNTVDLKEQEQLSKDKRPTISHFTIQCPDKV

MapolyY_B0018.21  

Gene structure:

mRNA Chr_Y_B:781549..812221  ( + strand )
five_prime_UTR Chr_Y_B:781549..782427  ( + strand )
five_prime_UTR Chr_Y_B:782635..782876  ( + strand )
CDS Chr_Y_B:782877..782886  ( + strand )
CDS Chr_Y_B:786613..786709  ( + strand )
CDS Chr_Y_B:797575..797608  ( + strand )
CDS Chr_Y_B:797741..797797  ( + strand )
CDS Chr_Y_B:799836..800681  ( + strand )
CDS Chr_Y_B:802307..802693  ( + strand )
CDS Chr_Y_B:804680..804713  ( + strand )
CDS Chr_Y_B:811461..811510  ( + strand )
three_prime_UTR Chr_Y_B:811511..812221  ( + strand )

Sequences:

Gene

>MapolyY_B0018.21
CTGCTTTCACTCTGTAGTGGGGATGCTCATTTTGCTCTTTCAACGAATAAATGCATTCAGTATATTCGAATTCCATCCACAAAGAGTCGACAAGCAAAGTATGGGACTTCGCAGATAAAAGACGGGACTCCATCGGGTGTATAGGACTGTCCACTGGTCTCGACCACAGTAATTACACAACAGCGATAGTATTTATTCAAAATACGCTTCGTGTGCTTCTTAATATGAAGATCACGCAGTTAGAGGATTTGAGTGATCCTTGGAAGGAAAATTTGAACCGTCTACCATTTACTTGGGACCGAGGTCCTAATTAACTAGACATTGATCTTCTGAGCTATCATCACGAACTGGACGAACTGGATGATATCTGCAGGAACTTTCATATGTTCTGAAACATATTACTTGCGATCTTACGTAAGTTACTTGAAATAAAACTGCCATGAGAAGTGTTGGGTTGCATTTTTATTCCGTAAGACCTATTCCGTATATAAACTGACGCACTACAAATAATACGAAAATCTGTTATTCTGGCGCCTCGATTTTGCCAGTTATGTCCAAGCATGGCTTCCGTTTGGTGCCATGCCTGTGGTCCTTGTACCTGTGTTTTACACTTGCTTCGTTGCTTCGGTGGATTGTCGATCCTGCTATCTTATTTATTAACCAATTTTATCACAGACCTGTAAGGTTTCCGCAGGTGAAGCCACTAGTATAGAATAGAAATAATACACATCAATGTCTGTTTGTCCTTATTTTCATGGTTCAAAAAGCTAGAAGATTCTTCGGTTGCACGTTTCATGATGTGCAGTATCAAATTTTACGGGCACATCTTGAAGAGCAAAGGTCTATTGGGGGATTTATCCATCTTTATTTAGAGCAAAGGTGTAACTTTGCCGCTATTTAAAACTATAGTAGCTTTCTGTCATTAATATGTAGACCGTGTGAGATATTGATTTGCAATATTCACTTCTATGTTATGCACGATTCATAGCGAGATATTGATTTGCAATTTTCACCTCATGTTATTCACGAATCATAGCAATGAAAATTACTTGTACGCTGTAGCACTCAAGTGGTTTCTGTTGCCAGGGTGCTGGGCTGGGGTGATGGGTACTTCAAGGGTCCAAAGGAGAGTGAGAACGCAGATCCCAGAGGCACGGAGAAAGATCAAACTTGCCGTGAAGAAGATCAACTGATAAGAAGAAAAGTTCTGCGTGAACTTCAAGCTCTTGTTTGTACTGGAGAGGATGATACAACGGCCTCCACTGGATTGGATTATGTAACAGACACAGAGTGGTTCTATCTTGTTTCCATGTCGTATTTCTTCTCACATGGTGTTGGGTAATGTGAAGAGTTCTATTCTCTTGTCTTGCAATTGTGTTATTTGTTTTACAACATTCCATTGCTGTGAGCAATATGTGTCGTGCAATAGATGTGTTTAAAAGAGACTGTTGTCTGTTGAAGGTAACATCTTTAAAGGGCAAAAGTTGTGTGCGTACTACTACTGCTACTACAATTAAATGTATACCTCTCACGCAGTCTTACAACTCGGGCTGACGGAGATTTATGGAACTGATTTTACATATTCAACTGCTTTCGGAAAATGGTCATTGATGCACTGTTCTGAATATTATCTAATCAGTTAGGTTACATACTCCTGTAACCTGTTTTATTCTTAGTTGTAGTTGCAGGGTTTCTCTCTTATATGAAGTTCCTGCTGGGCAAGATTTCGTGCATTGCTATCGGATTAGCTGCTTGTTCTTATTGCTCAAGCTTTAAACAAGCCATTTCCCCCACCTCACTCTTGAAAAATGGTTGAAACCTGGGGTGATAGTTGTTTATGAAAGCATGTATTGAAGCAACCTATGGCATAATGTTAGACGCTACTGCCACAATTGTTATGTGGAAGGTGCCATAACTTTTGTTTATTTCTGGATACCAAGTTTTGGGACAAATTTAGAATATGTCGTACTCTGCGGTCACCGTTAGATGAACCGGAGCACTCCAGGTTCATCTCTTTAGACTACAATTCGAGTACTATTTTAGTCTAGTGTCTGCTAGAGTAATCTATAAGCTTGTGAAGAGGAGGATGGCACTTCTACCCAGCTACTGGGACACGTGGATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCAGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAAGTCATGTGCTTCTGCATAGCCGTTAAGTTTCGGTGACTATCGTCTCAGTATAATTACATATCAGGTCATGCATTACATATGCACAGTTCTCGTGTCCAAATGTGCTCAATATCACCGAGTTTAAGTCTTGATTCTCTACTATGTCAGGATTCTTGTCTTGGCACCGTGTATATGTTAATGCTGTGGCCTTGTGATGCCTCATGCTCTAGCCCGAGTTACCTCTCCGAGAGTCTTGTAAACAGATACAATCTGGCAGGATAAAACTTAGAAGTTACCTTTCTCGTTATCCGGGTGCCAGATTCTTCCCGACAAACGGCTACAAGCAAGTGTTCTATAACTTATGGCCATTGATTTTTCTAAACACTCCGATCACTGCTATCTAGCTAAAAGTGTAAACCTCACAGGAGAAATAACTATAGGACCTTAGTAAGTTAGTTCTGTGTAGAAACAGTTAGGCTTTTGCTGTCGTTGATTCGTATCAATAACTTCACAGGAAATGGTGTTTGCGACCGCACGACCCATTTAAGGCGGATGAGACTTTGCAGAAATAAGTGACTTGACTTGGTTTCAGAGCCTTAGGGTGAGCTTCTGCTTTAGATCGCGTACTGGTGATGAGCTAGATCAAACAACACCAATTTTAAAGGTCCGCTACATAATGACATGTATAGTTACAGGTAACATACATTAGTTTCAGTATTCAGTTTTAGCATATTGAACTATGCCAGCGCCTACCGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTGTCCATATTTCCTGTTCGTCCTCAGTCTTGAGTATAGTTACAGGTAACATACATTACCATTTCAAAACGTGGGAGGTAACTATATCTTGTACTAACTTCCCCTCAACAACGCCTAATTCCTACATCGCATACCCTTGAGTTTCAGTATTCAGTTTTAGCAAATTGAACTATGCCAGCGCCTACTGTTTAAGCTTGAGTTGCATCATGTATTTCACTTTATCCATATTTCCTGTTCGTCTTCAGTCTTGAGTAGGATTGAGTTGCATCCTCACATAATCCTACTCTTTGTTGTGTTCTCTTCTTTCTTTGAGTGTGCAAGGGGGCTATGTTGAACAGTTTGATGTGAGCAACAAACGACCACTGCTTTGATCAAACTATGCCGGAGTTTTGTACCTATGGAGACAGTCTAGTGTCAATCTTTTGAGCAAGTGGTAGGTACAGGCATGAGTTCAAATTGAGGTTTAAGTGTCATGGGTATGCGGTGGGTAAGCGAGCATTGGCAATCAATGTGCAAAAAATACACCACCGAAGGGTCTTTGTTGAACTTACAGAACAGCTCACATATGCTCAAGCCTGGTCTCTACTCAGAAGCACACCAGGCCTGTGAAAAGGATACAAATTTCTCATTCTGCACGACTGCAAACACAGCTATACTCAGGAAAGTAACACAATCTGCTACATTTAACATGCCACAATCCAAGCCACCCATGTACTTATTTAGTTTATCCTCGCTTTATCAAGACAACATTTCGATTTGCAATATGTAGCCTTCTGTACCCATACTTGCGAGCATATATTGGCTCGTATACATAATACCACCAATGAATCACGTTCTTTCATCAGGTGACAATCATTTGTTTGAACTTGGCTTTGACAATATGTACTTTCTAGTTTTTTTGAGACTACTGTCTTTGTGTTTTCTGTATCATTCTGGTGCCAGCCAACCGTATGCTGTAGCCGCAGGTCACGGGGCAAAAACTTGGACGTTAAAACTCGCTATTGTAAATGCTGAAAGCAAAACAGAAAACAGGGCTGTGTCAATCTGGAGCCGTGGTGTCTCGGCGCTCCTGACTTTACGGTTGTCAATAGTTCCTGGAATTTGAGAGAATTTGATTTCAAATCAGTAGTCCACATCACACTTGTTTATCTGCAGTAAAACTTCATATGATTGCATGTCTCAGTATTTTTTCCTTGATTGCACGTGAGTTTTGTATATCTGTTTTGTAGTGTTCGATCTTCACTTTCCGTTTCTAGCCTTTCATTTGTATCACCGGCATTAAGTTTAAGTTTTTTTTTCCTCAGAGGTACTTACCCAGATAAATTCATATAGCATTAGCTAAGCTTGTGGTCCCTCTGGGTTATGTTATGGATGCCATCCTTATAATATTTCTCGCTTATATGCGGAGTTGCCTGCGCTGAAGCTTGTGTAGTGATTGCCTTTTTTAATCCAATAAAGCTAAGGATTGCCTGTTATATGGAGTTGCTACATTTCTTCACTCATTTTGCATTTTGTTGCCCACCAGCTGCAATCCTCTTAAGACACTTACATCCATATGTTGTGGTATTCAATGAGAATGGACCGACTGAGTAATGGGGGTTTTTTATTATGTGATTTTTAGTATGGTCATTCAAAGTCAACCCTGCCTTTTACTGAGATTTTATTTCCCACTTGCTGAAGACGGAAGTATTGAAAATCCATTGAAATATCGAAAGTGAAGGTTACCATCGTTCATAAAAGTGAATATAGAGCCGAACTCTGCTGGAGACCAGTGGCATTCACCCGCTTCCTGTTCCTGTTTCTGAATTGCTTGTGTTTGTGCCGCTTACACCAGTATCTTTCCGCCTTCCTCCTATTGTCGGAGGAAGCATGAAATTTTTGGAATCTAGTGACAATCAGTTGCTCATGAATAGGTTACTGAGTTGGGACTCTAATAAGTCGTCTGTTCGATTCAACCTCATTAATTTCTTTTTTGGCAATGCTTGGTGCAGAACGCCAGGTCAAGCTCTCGCTAGTGGAGAATATGTCTGGTTGCTGGAGGCGAACAAGGCTCCTAGTCACGTGTGTACAAGGGCTGATTTGGCTAAGGTAAGAGTGGGCAATCCATTCAGGTATATCCTTGCGAATGTTCGGTCCTCGCTGATTAACCCAACTTTAGGCTTCATGTTCCTGAACCTTTTTGGATTTGTGTCCTTGAACTTGTTATCCAATAAAAAATCGTTTGTCGCTTCTTGACATTCTCCTAAAGCATCGCGAACGTGTATACGAAGAACTTTTAGTTCTTTGTATACAAAGAATATCTCGAATGTACGTTGACATATCCTTTAAATACATACCAAGACATTTTTGGCCATGTGTTGTCTTCTCCACCTATTCCTTAAGCGTCTTGTTTCTTTGCAATTTCCCTTTATCGTCTTTTTTAGGCTTATATTTCGCAATCTTTGCGTTTTTTGTATAGCAGTGAATAATTTTCTTCCCTGTGTTTTCTGTGAGTAGATATATGTACTCTCATTCTAATAAATTCCGTCGACTAAGGCCCAAATAAATTATAATTAGATTATCGCTTTCTAGCATCAGTGATGAGAATTTATGAAGATTTGACTAACCTCACATTGAAAAGTTGACAGTCTGTTAATGGGATTCAGGAGAGTCATGTTTACTGTTTAAAGCATCCTCACTGAATTTTCTTTCCCAGATTCAGTCATGGTATATGAGTTCTAGGCTTGCTCAACGCTTCCTGACTAGATATCGGTACTATGTGCATGCTAGTCAAAGGAGTGTATAATGCTTCTGTGCTCTTCCTATTGCACACAGTTCTTTACCGTATGATGAGTAGATTCTTTTGACCCTGCCAAAGTATCTGAGAAGAGGCAACTGTATAAGCTCTCACCTAGACTGATATCTCTGTCAGGGCTCATAACACGCACCGATAGAGTTTAACTTTCAGATCCTGAAGACCATATACCGATGCCAGTGGTGATAGACAGTGAAGAAGAACCAAATTGAGAAGAAGAATAGGCGGAAGATAGAGAACCATATGACAGCGAGGAGGTCTTTTAGAGTATGATCTTCCTCTTTGATTGGGATTTGTTCAGTAGTTTTTCAACGAGACGTTTACAATAGAGATATCATATGCTACACTATCGGTATCTTGAACTCCAACATATTACACGACTACTTGTTGAGAAACGTACACCATTTTGAAAGATGTTACGAAATATAACATTGAAGAACATGTTTACCTCCACATGTATCTCCCCTTTCCTGGGGTTTTTACATCTTGGAAATTGTCCATGAAGATATCTCGCCAAGGATCTTCAAGTAAAAAGAATAGCATGGAGGCCTGCCCGCCCTCACCAGCATTAAATTTTTTTCTTCATTTCAGATGGCATCCAAGTAGGTTACTTTGATACAAATCTGTTACTAATTTGCAGGTAAGATGGAATGTTATTTCTGCTCCACGTTTTCATATCTGTCATAGCCCCGCCTCTCGTATTGAGTACTTCATCTTGCTACAACTTCAACTTGTGATGCTTGGTCTCCATTGACTGGGTATAGAACTCTAATTGACGTTTTCACGCCTCCTTCTGAATAGAGATTCCTCAAGGGGGCTGACGATATCTTTGAGGTAGCGGGACTCCTTCCATGGTACCTTCGTGGTACCTGTTAACACTTTTCCAGTTTCACAGTTATTTTATTCAGTGTTAAGTAAATATGAACTCGTTTTTTAGCATTTCTACTTGATAAAATCAGAGAAATATAAAATAGACTTCTACTCACCTATTCACTCTTTTTGCCTTCTCCCTCCCTTCCCCTATCTTCTGTGCCGCTTATCATCGTGTCTTCAGAGCTAGAGAGCGCTTGGCAATATGCTCATAGGTTGGGGCAATGGCCACGGACACAATCTTTGGTTTGTTGGGCTCTGACCTATCCTCAGCCCCCGCACGGTCCAGTACAGAAACCTATGCATCTCGTAATCAACTGATGAAGCCGCTCACCATGTGCGATTGGTATTTGTCTCTTCTCGTTCCAAAAAATTGACATCCATTGGAAGCTATACTTGAGTCGGAATGGCTGTTTCATGCTGATCACTTAGATCTCCAGCCACGTCCCATAAGCTGCAGGTTTTCTTCTCGTGCGAACTTTTGTCAGTTTCTTCCATTTCTCCATCTGTTTATTTCCATTTTTTGTCCTCTTAAATCTTCACATATGCTGTCTCTCTAGTCCGGGTTTTACATCATCGGATGATCTTCATGTGCTCCGTGTCTGCATATGGCATCCTCTACGTCCATGCAAGATGCTCTTATCTGCCCTTGCTACAGTTTTCCGAAAACTCATTAACTCACCTCTTCCCCATTTAGTTACTAATTATTGCAGTATCCTTCCTACAGTCCAACAATGCTTTCGTCTCTATAGTTCTACAAACTTTTGACATGTGCTTAACGTTTTATTATGTTACTCGCCTCGCAGTTGTTCAACAGAGCATCAAGCGCTTTGTCAATTCTATGAAAGAGTCGTTGCGACAACAGGTATCATAGCTCACTATGATAATCAGCCATTGGCCTCCACCATTTTCTGGCTGCTTTGGGGGTCAACCGTCCAGTCTGGTCTTTCATCTAGCCGCATCCTCCAAGGCCTGGAGGATATACAGCTTCCTCACTGAATCTCTCCCGATTGAGAACTTTCCAAAACCCCTTCGTTATCACTCACACATGTACTCAGAGTTTTGTTTTCACCTGTCGACTTTTCTAGCAAAAAATTATCTCATCAATGTATCAGGAAGTAAAGCAATGCATGAAAGGGTCGAGACACAGGTACTGAGTCCTGGAGAGAAGATCTTAGTTATTGGGGAGTGAACCCGGATGGGGAATATATTTCCAATCGTGACAGTGGTTATCTGAGAGATACAGGACCCTAAACCGTAATGGACAGCGGCTGGTCGTGACAGTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACTCCCACTTATTACCTATTTACTTCGCTCATCCACATTTTCAACTAATAAACCTAAATTCTGATTATGATACCACTGCTTTTCTCTAGCTAATGGTTTTGTAATAATTTCAGCAATCATCTCTTCAGTTGGAACTTAAACAACTTCACCAAATTACAGGTGACCAGATCTCTGACAAGATGATATCTAATGTCAATGTGCTTAGATCTCTCGTGATTTTTGTGGTTCTCTATATGTGAGATCGCACTTTGGTTGTCACAGAAAATAGTGGTCGACTCCAGCTCAAAACCTAGATCGGTCAGTAATTCTCTTAACCACATAGCTTCAGCTCCAGCCTTGGACAAATCCATGTACTCTGCTTCTGTAGAAGAAAACGCTACTGACTTTTGTTTCTTTGATGTCCAACTAATGGTTCCGCCATTGAGTTGGAAACAATATCCAGACGTCGATCGTCTCGTGTGAAGGCAACCACCGGAGTCCGCATCGGAATATCCAGTTAAACCGGATGGTTTGTCAACCCTCGTGAACACAAGGCCAAAGTCGAGAGTTCCTTTCATATATCTGAAAATCCTCTTAACTGCCTTCCAATCTGTCAATCCAGGATTTGACATGAACTGAGCCACAGAACTGACAGCAAAAGATATATCGGGTCTAGCGCAGACCATAGCCCACATCAAGCTCCCAACCGTAGCTTGATATGGAATATGTTTCACCTCTTCGCTTTCTCCCACTGAATTGGGAGAGTCAAGCACACTTAACTTTAAACCGGGTTCCATAGGTGTATCAATAGGCTTACAGTCAGCCATGTTGAACCTCGCAAACTTTTCAACCAAATATTGTGGTTGGGAGATCCGAATCCACCCTTCTTCACGATTTCCGTCAACTTGCATACCAAGACAATGATAGATCTCTTCTAAGTCCACCATTTCGAACTCCGTTTTAAGTTTCTCCTTGATCTTTGTGAGGAGACGCAAGGAATCGCTTGCCAGTATACAGTCGTCCACATACAGTGCTAAATACACAAATGCATTCTCCTGAGAGTAAATGTAAACATTCTGATCTGCATTAGCCTTGGTAAAGGCAATCTGCAGTAAGAACGAGTCAATCCTCTAATACCACTGTCGTGAGGATTGTTTCAGTCCATAAATGGACTTATTCAGTTTACACACCATGTTTTTTTCAAAAGAGATATTCAACCTTTCAGGAAGGGCCATGTAGACTTCTTCATCCAACCGCCTGTTTAAGAATGCAGTTTTCACGTCCATCTGGTGCAGCTCTAAATTGTATTGAGCTGCTAGAGCCATTAACACCCTAATGGATGTCATCTTCACCACCGGGGAAAAAGTTTCTGAAAAGTCAACACCATAAACCTGTGAATAGGCTTTGGCTACTAACCTGGCCTTTTATTTGATTTTGTAAATCCATTTGCAGCCAACGACGTTCTTACCCGCAGGTAACTCTGTCAGTGTCCAGGTGTGATTTTTCTTCAAGGAAGTAAATTCGTCCTCCATAGCTTGTTTCCATTTGATGGAATTAGCATTTTGTAAGGCCTCTTCATAAGAAGTAGGTTCTTGGTGAGTCTCTCCGTATGAAAATAAACCTCGATGCTTCTTCCTCTTCTCCAAAAGTTGATCATATCTTTCGACACGTTTCCTTACTCTTTCCCCCCTTCGAAAGAGAGGATCGATGGAGTGGGAAGACGATGAAGCATCCCCCGTAGCTGCAGGCGGGACTTCAGATGCAGTGTTGTGAATTCGGAGTTCTCCCAGTAAGTCTTCGAGGTTGCACACTGTATCATCAAGAGGAGCCGAAGAGAGAGAATTCTCCCGTAGCTTCCACATGCGTCTCTGATAAGTCTGGCCAAAACGGGCTGGATAAGTTGCAGGGACTTCAACAGTGGGAGAATGACTTACGGATGAAGTGGAAGTTGCCTGTGGAACTCCCACTGCATGTGATGGTGTCAATGGACTGAATTCTCCTACCGCTGGTGGCCGTCCTGCTGGTAGCCGTTGTGCTGGTAACCTCCTGCGAACTAGATGAGTCGATGGAGCTAATGGAACAGAGCGAAAGGGAGTAGAACCTTCTTGCTCAGCAGACGGAACAACTGATGCCTGCTGATGGTGAGAGGTAGCTTCTCGAACTGCAAGAGGCATAAATCTGACGGATCTGCTTTCAAGAATCTTGTGAGAGTCCTTTCTCTGTACGCGATATCCTTTGGCTGTAGTAGAGTAGCCAAGGAAAACACATTCTACACTCTTGGGGTCAATCTTACCCCGATGGCCTTTCTCAATATGAGCAAAGGCAGTACATCCGAAAACTTGTAGGTTCCGCAGATCCGGCTTCTGCCCATGCCAAAGTTCGTAAGCGGTTTTGGTGGTGGGTAGAGCCTTCGATGGAGATCTGTTCTGCAAGTAAACGGCTGTATGGATGGATTCTCCCCGATAGCCATGAGAGAGACCAGAATGTGTCAACATGGCAACAACAGAATCGATCAAAGTTCGATTCTTCCGTTCTGCTACTCCGTTTTGTTCAGGAGTATCAGGAATGGAAAACTGTCGTTGTATGCCGTGAAGGGTACAAAAATCAGTAAAAGGTCGAGATTTGTATTCAAGAGCATTATCTGATCGCAGAACCTTGATGCGCTTGTTCAGGTAATTTTCAGCCATTGCTTTGAATTCCTGAAACTTGGCAAAGGCTTCAGACTTCTGTTTTATCAAATATACATGCGTATATCGTGAAACATCATCGATGAATGTGATGAAGTACTTACAGTTCGAGAATGTTTGAGTTCTCAGAGGGCCACAAATATCCGTGTGTACTAGACCAAGAAGGTCTTTAGCACGAGTGGCTCCTTTTCTTGGGAACTTTGCTCTTGTGGACTTCCCTAGAGCACATGATGTGCAGAAAGGGAGAGTCCGAAAGGAACATTTCTCCAACCCTTCTACCATGTGATGCTGCTTCATTTGCTGAATTCGCGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGGTAGGTGTCCAGCTCTTCGGTGTTGGAAGCCGAATAACAAACCTCTGCAGAAACTGCAGGTGTCTTGAAAGAAGTAGTTCCAAGCCTAAACAGGTTGTTGTTGTTGATGCATTCAGCAATGACGTTACCTTTCTTCCCCTTCAAGATGCATCGATCTGGTTCAATGAGTAGACTCCCTCCTTGCTGAACAAGCTGATGAATAGAAAAGAGATTCTTGTGGAGACCAGGAACGTGTAACACTTCAGGTATTAGCCGTTCTTGTCCATCATTCAAAGAAACGAAGACATTACCTTTTCCCTCAATGAGTTGGCGACTATCATCGCCCAGATATACAAACTCCTTCGATGGAAGTTCAGTATATGTCACAAAAGCATTTCTGTTGTATGCCATGTGTTGAGTTGCACCAGAATCTACATACCAGGCTGGATCCATCCCAATGGATGTTAGAGCAGTGACATACAGCCGTTGGTGTTCGTTTGGTGTAGAATGTGAAGAAGCATTGTCGTGTTTCTTCTTCCTGCACTCGCTGGCAAGATGACCTTTCTTCTTGCAGTAGAAACATTTCATCTTTTGCCTGGGAAAAGATGTCTTGGCAGGAGGTTCTGGTCGCGATGAAGGACCTGACTCAGTGAAGTGTCTTGGATGCATCATCTTTGGCGCCCCTCCTCGTTTCTTTGCTGTGTAGAGTGCTGCCATACCTTCTGTCAACTCTTCCTCTTCTTGAAGGTGTGATTCTTCAAGAAGAACACCAGCAATAACAGATTGGGTGGTCAAATTTTGCTGTGTCCTCATGGAGCGCACAAAGGATCTATACTCAATGGGTAGACTTCGAAGGAGACAGGTGTAAGCTTCTGCCTCTGGAACGTTCTGCCCTATAGATGACAACTGGTGAAGAAGTAGACGAAACTTTGAGATATGTTTCGCTACAGACTCGCCTGACTTCATCTTGAGAGAATGCAATGAATCTCTCAAGTGCATCTGCATTGGTACATCATGGGATTCAAAAAATGCATTCAGTTCTGCCCAGGCCTCTGCAGCTGTAGAATGACGTGCGATCAATGGATGTTGATGGTCTTCCAACGAGTTACTTAACACCGCCAAGGCCATGAGATTTTTGACATCCCATTCTTGTTTACTGCCAGCGCCTGACTCTGGAGTTCTTGTTGTAGACCCCGGTGGAGTGCTTGGCCTGACTTCGACCCCTTCCATGATGTCCATCAGTCCTTCCAGTTGAAGGATTAAACTAATTTTCCCCTTCCATGCATGGAAATGTTCCCCACTGAATTTGGGGAGGGGGAGCTCTTTCCATGCGAACCGGGTTGAAACCCCAGGAGAAGTCATCTCCCTGAACTCGAACTATACTCTGTGCTGAGCTTCACGTTCTGCCGAAGTGAATCTTCAAAGAACAAATCTTCGAACTCTGAACTCTAAACCCTATCGCTCTGATACCATATCAGAAGTGAGGCAATACAAGAAAGAGTCGAGAGACACAGATACTGAGTACTGGAGAGCAGATCTTAGTTAATGGGGAGAGAACCCGGATGGGGAATATATACCCAACCGTGACAGTCCGAGAGATACAGAAACCCTAGTGGACAGCGGCTGGTCGTGACAATCTGTCACGACCCCGACTATAGTACAAAGTACATACAGCAAAGAACGTGAGTGTACGGAGGTCCAAGAAGTGGGTAGTAATTCGACTCTAACAGATGCTGCTTCATTTGCTGAATCTGGAAGACTCATATGGCCGAGCTTGAGATGCCATTGATAGGTGTCAAGCTCTTCAGTGTTGGAAGCCGAATAACAAACATTAGCAAGAACTGCAGGTGTGTTGAAAGAGGTCGTTTCCCGCCTAAACAGGTTGTTGTCATTGATGCACTGAGCAATGACGTTACCCTTCAACGAGTAGACTCTTTCCTTGCTGAACAAGCTGATGTATTGAAAAGAGATTCTTGTGGAGACAAGGAACGTGTAACACTTCAGGTATTATTAGTTCTTGTCTCCTCGGGGACATCCGATAAAATTGGAACAATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGACACGCACAAATCGAGAAATGTCCATCATTTAACGAAATGAGGACATTACCCTTTTCCTCAATGAGTTGGCGACTGTCGTATTTTTGTATGCCATGAGTTGAGTAGCACCAGAATCCACATACCAGGCCGGATCCATCCCGATTGATGTTAGAGCAGTGACATACAACCGCTGATGATTGTTTGGTGTAGAATGTGAAGAAGCGCTGTCGTGTTTCTTCTTCCGGCACTCGCTGGCAAGGTGACCTTTCTTCTTGCAATAGAAGCATTTCATCTTTTGCCTGGAAAAGGATGGTTTGGCAGGAGGCTCTGGTGGTGATGAAGGACCTGCCTCAGTGGAGTGTTTTGGATGCATCATCTTTGGCGTCCTCCCCTTCGTTTCTTTGCTGTGTAGAGTGCTGTCATTTTGTCGGTCAACTCTTCTTTTTCTTGGAGGTGTGATTCTTCAAGAAAAACACTAGCAATAACAGATTGAGTGGTCAACGGTTGCTGTGTCCGCATGGAGCACAAAAAGGATCTATACTCGATAGGAATAGTCTGCCCTATAGATGCCAACGGGTGAAGAAGTAGACGAAACTTGGAGATATGTTTAGCTAGAGACTCGCCTCAAGTGCATCTGCATTGGTACATCATGGGATCTAAAAAATGTATTCAGTTCAGCCCAGGCCTCTGCAGCTGTAGAATGGCAAGCAATCAATGGATGTTGATGGTCTTCCAACGAGTTACTCAACACCGCCAAGGACATGAGATTTTTAACATCCCATTCCTGCTTGCTCCGTGAGCCTGACTCTGGAGTTCTGGTTGTAGAACCCGGTGGAGTGGTTGGCTGAACTTCAGTCCCTTCCATCATGCCCATCAATCCTTCCAGTCGAAGGATCAAACTAAAACTGCTCTTTCAGGCATGGAAATGCTCCCCATTGAATTTGGAGAGATCTTTCCATGCGATTCGGGTTGAAGCCCCTAGAGAAGTCATCTTCCAGAACTCGAACTATCCTCTATGCTGTGCTTCACGTTGAGGATATATACCCAATCGTGACAGTGGTTATCTGAGAGATACAGGAACCTAAACCCTAATGGACAGCGGCTGGTCGTGACTAAGTGTCACGACCACTGACTATAGTACAAAGTACACTGACTATAGTACAAAGTACAAACGTTCTTTAACAGAGTGTACGGAGGATCAAGAAGTGGGTAGTAATACTTCTAACACAGTGGAACTCATCTACCTTCCTACCTATCCTTCGAGCTCAGGGCTCCATTTGTAAACTGCACTCAGAGTTTTGCAGACAACATCCTTCTTGACTTACTAGTGGGAACACTCCCTTCCTTTTTCCTTCATAGCCTGAAACTACGGAGAACGCTTCCGAAGTCGCGATGTACTGCCTCTGCTTTTTACTCTTATATTACACTGCCTAATTTAGCTATGTGTGTTCACACGGCACTTATGCTTGTGGGACATGCTATTGGTGACTTTGAGTTCACGACCATTTACACGAGTGTCAATCTCGTAATTTTCAAGTTTAGCTTTGCCACAGTTATTCTTCAGTTTTTCCTCTAGGTTGCACTTAATACCACAAGAATCTAGTAGTCGTCGAGATGGATCGGGGCTCGTCTTCTTGTTGGGTTCGTTCTGCTACAGGGATCGATGGGAGCTCCTAGAACAGTAAAAACACTTTCTCCGACTTTATTAATCTGCTGTTTAGATTTCCTCTTCGACAACCCCTATGTCTAGTTCCAGAATAAAGTCTACCTACAGGCTAGTGGTATGCCCATGGGTACACAGCTTGAAGTCTTCTTAGCTAATATTTACCTCTTCGCTTACTTATCGGAGCTCATCAAGCGGATGCTCTTCCTACCAAAACATAGTACTCTTTTTCACCGTGTTACATGTGAGACGCCACGTTGATGACGTGTTCGTTCCAGGAATTTTTGTGTTCGAGGATCTGATATTATCTTTCATCTCATACCATTGAGGAAGCATCTACTCGCAAGATTCTTGTTAATACAACAGGACACTCCACGGCGAGTGAAACAATAAGTTGTATTTGGCATTCCTTCGAGTTCTATTTGTAACAAGGACTCAGGGATCTCTCAGGACGGCCTCAAACTTTTGATTGTTGTCTATGTCTATGATATACGTAGAGAACCTCACTTTAGTAGACATACTTTTATCATACTACCTCTGGTTATCCCCATAATTTCTTATACGTCCAAGCCCAGGGTCATCAGTTACAGGTTCGACTTGTCATACATATATTAAATCTGAGAATAGACTTGTTCAGGCTATCGTTACGCTGATCCACAATTTAGAATATAGCACTGCGATATACGTATAGTTTTTGTGGTTGAGGCTCTGTTCTCAGGAAGGTGTTATAGTTGGTTATCTGCGATGGGAATCTACCAAATAGTACGACGGTTACCCACTATTGGCGGGGAGCTTTATGTTAAGCCCGCTGTCTAGGTCTTAGGTCGTCTTTCTGCTCTTCTTGAAGTGTTTACAAAGTCCCTGGACGTTTTCGGTATTTTCGTTAACCTGGTGCTATATATAAGGTCCTTATTAACGAGATACAGTAGGCGGATGTAACTGACTTCAACTTTTGTGTAATTCCATTTCTGACTTGTATCGTGTTCTTTTCATTGAGTGTGATGTGAAATTCTTTCTCCTATTTACGGTGGATGGACTTCACATCGGTTTTCCCATATTGTCCTGCATGTTTATGTGAAGTATCAGGTCCTGATTAACGAGATGAAGGAGGCAGATGTTTCTCACGTCACCTTTTACGTTATTTCGTTTCTGACTTGTATCGTTTTCTTTTCATGTTGGAGTTACTCTTCCATTCAAAAGATGGCAGGTATACAGGTTAGTTATCTTTCGAGACAAATCAGAAGCAATCAGCACTTTTTTTTTTAATTTTACCTGGATTGTTGTCTGCATTGCGCTGATGAAGAAGTACATTTTCTTCTCAGTAACGACTCTTCTTTGTATTTGCAGACAATCGCATGCATACCAACAAAGAATGGTGTGGTGGAACTTGGATCGACTGAACTGGTAAAAACTTCAAATGTGTTTGTCCTGCTTTGTTCAGGAGTTCGACTCAGACAAGGGAAGAATCTGTGCACTTGTGTGCCGATAACATATGTAGTGATGTATCAGTCTGTTTGCTAGTAGCTGTAATAGAAGTACCAGCATTCATCGTTACTGCTCTCATTATTTCACGCCCCGACCTTTACCCTGCTGACCAAAATTGCTAGTAGTCTCCAGTCACCCCAAGGTATATTTCAGTCTTCCACCAGCGGTATCACGCAGACCTTCTTACAGTAGTTTTGCTTTGTAAATTTTAGAGTTTAATAGTAACATCCATTTATATTTCTATGAAATAACATAGTTGTGCTTCCTGCGAACCATTATATACTGATTGTCTTCCTTTGAAGAGCAAGTAACATCAAGCACGTCTTACTATCACATTTCAGATGTTTCTTTTCGTCAGTACTGTGATAATCGTATCTGCTATCAAATCAATACAATATATTATCTTCAGTACTTCTCATCCTTTTTTTTCTGTGCAAATATTCGTCTGACGTCTTAGTGGTCAATCCTAGATTGAAGTTATCATTTCTTAAGGAGATCTATACTCAGATTGTGGCCTGTTGCGGAAAACCAAGTATTATTAGCAGTCTTCTACACGAGAGAAAGTCATGTACATGTACATGTCCAGTGTTCCTAGCATGCAAACCTGATTCCCTCCAAGTGGCCTATGACTCTCTTGACAATCGTCCAGTGACTTCAACTTGGGTTGATAATGTGGCGAGCTAAAAGTTGCGATCAATGAGCCATGCCCTGGCAGTACGTATATCAGAGATTGTGTTGTACTCTCACAGGTGTTGTATGTTCTCATCATCCTCTTCTACACTGTCCATCTCCTTCTGTCGTTTGGTTCCACATTTTAGAGGCATAGGTACTATTACTGACTTTGACACAGAAAATTTCGGTGATTTTCATTGGTGTAAGAGGGTATATTCAGTTGAATCTAGCCATGTCACATTATTCTCTCTACTTCTCTTAGTAGTAGAAATTTGATAAGAACCAACACTGTAATTTTATAAATTCCTGTCTCAGAACGAGTCACTTCTTGGATTGCTTTCTATGCTTTACCTTAAGACAGAAGATCATACACATAGACAACCTATCTCCTCTATGTTTGTTCATTGTCATTTTTGAGATAGAGATTGGGACCGGTTGACTATATTTTAAATATTTGTTTGCCGCCTTTGATAGTCCAGATTGGAAGTCGTTTCAGTTTCAGACTTTTTCCTACTTCCTATTTCCTATTTCGTAAAATGTCACTAGAAGTATAGGTTTTCCTCTTTGTGGACATTGCTATCACATACTCTTGTTGAGCTGGACCGAGAATATGTCAGTGCAAATGGTCAGCAGTATTTTCACCTACAAATAGACAATCCAAGGCAGCCCAGTAAGCATCATACAGTACTTCAAGCAGACTGTCATTGCGTTTATATTCACCAAATCTGTGAGTAGGCAGCAACAACATGTTTTACTACTGATTTCTATATCCTTCCTACCGAGACTTATCAAGTTCATATAGACTAGACGTACGAAGTTAAGAGTAAGCCTAACGGGCTCCATACTGAAGTAGAACCTTTACAGGTATGAATGTAAAGCTTGCAGGGTATCTTTATGTATGCGCAGAATTTGTTTGAACAAACAAGTTCCGCGCATATATAGACCTCGCGTTTTATGTAAGCTCGAGCCCTTTTTGAGTGAGGTACAGGAAAGCTTCTGTTTTTGCGTAGGCTTTGTTATCTAACTTTCAGGCCAAGAATCGGAGGACCAAAGAGGTAAAGGGTAATTTAATCATGATTTCCTTCTTCCTAGATTTCAACGAAAAGACAGTGGCGAGGTGGAAATCCCTATATCATATGGGAATAAGTGCCATACCTGGAGGAGATCTGTGCACATTGGTGAAACATTGTAAATTATGTAAATTGGTCTGGACAGATCAGTATGGGGAGATGGAAAGCAATTTAGTTTTTTTCTTGATTCTTTCGAATTTTTTTTCTGGTTGCAGATTTTTGAGAGCTGGGAGGTGATTAACAACATCAAAGAATTCTTCAGTGAGGGGATATTTGAACAAAGTCGCAGATATCAAAAGCCACATTTGAGTTCTGGCAAGATTGGTGCAATGGGTTGCACTCACGTGACTTATCCCACTGGAATTGATATCTCCAATGATGTTATTTCGAATTCATGTGTGAAGTGCAATACCTTCGATAAATTGAATGCGTCCTCTTTACCATCCAACGTGGATTCCCTCGATTATCTCTTCTCAGATGACGCCTCTTTAGTCGAGATACCTTTGGAGACCGACAAAAACCATATGCAACCTGTAGGAGTTCCAACTTTGCAGAGCAGATTGATTATTGAGGAGGACAAAACCGCTGTCTTTTCAAAACCACTATATCTTTCTTTGGATCAAGGCCGGACTGCAGTTAGTGAAACTGGAGAAATCTTGAATCCCCCGGAGATGACACTGAATCTGAGGAGATCTGAAAATCAGCTACAGCAAAAGGACAGCAAATTCTATCTCAAGAAAGAAACCATGTCCGTAGATAGCCAAAGTAAGGATCGAGCTGGAGAGTCTGCTAATCATCAGGTCGTTGATGCCAAAGGAGTATCTCTTCCAAGCTTTGTTGGGCGATCCAGTATTGAGTCTGAGCAGGATGTCGATTCTGAGGCAGAGGTGTCTTATAAGGATGTCGTGCTGGTAGAGCAAAAACCACCACGGAAGAGAGGCAGGAAACCCGCTCACGACAGGGAGGAGCCACTTAATCATGTGCAGGCTGAACGACAGCGGAGAGAGAAGTTGAATCAGAGGTTTTATGCTCTCCGATCAGTTGTGCCAAATGTGTCAAAGGTGAATGAATTTTGAGCATAAAGTGAATTCAATATATCATTTCGTTTAGCTGCAGGTTATTTTAATTTTGTATCTGTATTGTTTATGCATTGTTATTGTATCTTATTATAGATACTATCCGGTTTTCTGCTTATCTGTAGATGTATTGGTGTAGATGTAATGGTGTTCACACTGCATTTTGTTGTTTGGATGTTTTTTCCACGGAACTGACACCCCCTCTCTGGGATTTTGGACTATCATCACTGGTTTATCTGGATCTTGTTTTTTTTGGGTGACACTCGCTCTGTTCTCTGGAATTTTGCTTTATGTTCTGCATATTGTTTCTTTGTTCGTAGCTATATAATTCTAGGAAGTATCTGACATAGGTCTGGGCAACAGCGACCAATATGGTATTTGGGTTTTCCTCAGCCCCCCGCGGTTCAGTGCAGAAACCTATGTATTTCAGTAATCACTGGTAAAGCGGCCCACTTGTATGTGATGAGAAGTTGTCGCTCCCCGTCAAGATCTTGTTGGTATTTACTGAATGCCTTTCTTGCGTCGGAAGGGCACTTCCATACTGCTCACTAGTTTCCAACAGCTGTCCAAACGACAGCTGGATTTCTCTTCCTGCTTACCTCTCTTACTCTCTTCCATCTTTCACCGTCTCTCTTGTTTTTGGATTATCATGCTTGCATCTATTGGTTTCTATTCACGGTCCTTTCCATTATTTATTTCATAGTAGGAACCCGTGAGAAGTTGCACCTAGGTCCGAGATGTTTTTGGCCCCTTGCTTGTCAAGCCCGTGCGGTCGGTCATGTAACATGATATCTAGATATCATATGTCTAGCCCTAGGAGAAACTAGTTAAGGGGTTTTGTCTTCCGTGTCTACCTTTCTTTCTCGATTTGGGGTTTGGCGTACATAAATGGTGCTATTTATGGGAATCGTGGTGAGGGATTCTCTTCATGCATGCGTCTATGTGGGAGCGTTTAGACCAGTAAATGGTCCCACGGTGGTATTGTAACCCTACGAACACTAGGGGCTCATAGATCTTCTGATTTTGTTTTGAGGTCGTGCTTATTGTGAAGGAAAACTGTGAGGTCTCCTCTGAACACAGTATTCCATTTTAGCGTTCACACTTGCATGTTCTGAAGGGAACACACATTTGCACAGGTTGTGAACGAAAGCGGATAATTGAAGAGTGCCATTTGAAAGTGCTATAACATAACCTTGGTTTGTACAAGAGAAACAAGCTCAGAGCTACATCCCTATGTATCCATTTCAGCAATACGAAATGATATTGTCTTGTACTTCCACGCGAAGCTTTCTTTCGTTCTATTCCTGAACGTAAACTTATTAGCCTTACTGATCAATACGTCCATAATAAGTATTGTATCAAGACTTCTTGTTCATGTTAGATTCCTCAATGTTCATCACTGCAGATTTGGTCATCAGTGTTATCTGGTTTGATTTAAATAAGTGCTGCTTACCATGTGGGCCTTGCAGAAACTTTTTCGATAGAAGAAAAGGATATACATCACTTACTGTTCAGTTGGAATAATATAATTTATAATATAGGTCTTTTTCTTATGAGATGATGGTTGTGTTTATAACTCTCTAATATCGTGCCTGTTTGTGCTCTCGTAGATGGATAAAGCATCTCTTCTAGGCGATGCGATTGCCTATATTCAAGAACTTCAGCAGAAGCTTCAAATTATGGAGCTGAAATGTCAAAGTGTTCCCTCTAGTGGCAGGCCCTCAACTTCAAACCACCGAGGCTCCAGATCCCATCTGGATTATTCTGCACAGACAGGAAACACAAGATCTCTCCATTCATATATTTACATTCTTGACCAAAAGCCGAATGTCGATGTTGAACTCCTTGGCATGGAGGTCATGGTCAGGGTCAACCACTTGAGCGAAGCTTATCCTACCTCACAACTAATGTTTGCACTGCAAGATTTGCAACTTGAAGTGCAACACGCGAATATCTCCACCGTTGAAGACAGAATATTCCACCTTGTTATAGCGAAGGTACTTACCTACTAATTGGGATCGTTTCCGTATTTTATGAAGAGTGTATACATTATGATGCTTTGTGGTTATTATATGGAGATGTTCCTCACTGTCGGTTCTTCACCACACGACTTCTAGAACTGTCAATAATCAGCTCGTCGCTGAAAGCATGAAATCCTTTTTTAGACAAATTCTTTTAACTTATTTGTGAGCTTTTTTCTCCACTTTTCGTTACTCGATGTTTGGCGCTGAATTCTGGTGCGTGGTGGACTGCATATCTCCCTTTTCGTTTCACTGTCTGCCTCCTTCTTGTGTGAAGTGAAGTGCGTAATATGGAGGTCTCATACAGACAGCCCCCACTTATCTCCTTCTTGACATCCTTCTGCTCTCTGCTTGGTAGCCTGCAGATGCATCAGGTGATGCCAACTGCAGCCCTACCTAGCGCGGATCCGGGACAGAAACCCATGCACCTCAGTTCACCGCTGGATTTTATATGATATCAAAGAGATGCTTTGCCATTCAGCTGTTGATGAAGCTCCCTGAGCCCAGTTCCATCTACCACGAATGCGTACACGGGATGCCTTCTGATGCTTTGAACCTGTGCTTGTTCAGTTTTGACACACTCTAACTTCTTGTTCTTTGTTGTTTCATGCTTTCCGATGGTGCGTGTCAGTCCAACTGAAATTTTTGTCCTTGTTATACGTATAACAAGGTATAACAAGGACTTTTCATCAGCTTCTCTTCGTTGTTTCTCCTTGAAAACATCCGTTTGATTCTATTTCGTGCAGGATGATCTCTTGTAGTAGACTGTTTGTTATATATGAATATGTTCATTTTCATTGTTGATTACAGTCTCAGGATTCCTATTCAGCACTGATAGGATCTAGGCTAACACTTTCCTTCCGCGGCACCCTCTGGGTTCATTGCGCTTCCGAGACACTACCTCCGTTCTCCGTTTAACCCCTCAACGCCCTTCGTCCCGGTCATCAACTTGTGCCATGTTGGGTTCTTTCGCTTCCAGCTTCTTTCACGCATGGTTTCTGTTGCCTGTTGCTCTTGGACCTGGACTTTATCGGATGCTCTCGCTTACAGAAACTGTAAGCGAGACCGGGACGAAGGGCGTTGAGGGGTTAAACGGAGAACGGAGGTAGTGTCTCGGAAGCGCAATGAAGTTCACGTTAGCCCAAGGCGTTGGTTTTCATTTTGCATCCCCATAATCAGTTTGAGATCTACAGGCTTCCTTAAGACTTGTCTGCCACACTTTTAAAACTCATTTACACCCACAATTACCGGGTGCATGTATATATAACACACGTGTGGTAATCTGATAACTTCAGTATGATGTTTCTATATTTCTATCACAGTATGTCTCGTAGACTCTCTAACACTTACCGTTGCTTACTGCTTCCCCTCGTTCTCTTTTTCCCTCAGATGGGCTGTGAGCAGGAATAGTGAGAAAAGAACCAGTATCCCCTACACTTAATAATTACATCAATTCTTTACCTTCCAGTCTCTAAGTGTTGGGTTGCTACCCAACACGTAGATATGTGATACGTTCCTCAGGATATGATACTGGCAAGGTGAACTTTTTGACCCTCATTGATTTTCTAACAGAATGTCAATCCTATACCGTGATGATTCCCTAGGCAAAAATATAATCCTAACAGGAGAACCCCTGAACTTAAAGTAAATTGCTATTATGTTTCTATAACCTACTGTGAATCGAATTTACATCTTTACTGCTACTAAATTACTGCTGTAGTGTGACTTTGAGACAATCTAATCTGATGTTCATATCATGTAATTCTGAACAATAAAGCTCTTGTCCACCAACCTTGCCTTCGTCCTTTGATCAGAATTATCAGAGTGGATTATCCTACACCTTAAACCCTAAACATGTTGACCACCTATTTTGGCTTACTCTTTTGGCTTCACGCAATCGACGCAAGGTCAATGTCTCATTTTTGGCGATAGAACTAATTTCCCTCTTCATTTGTTTCGTAGGATCGGATTCTGTTTTACAGTTCATCAAATCCTTGTGAGTGTCATCTTACCAAACAAAATCTCCTTTGACAGATTTTGCATCTGGTTATCTTATCTCTTCATTGTGCACATGAGTAGATGCTGTGCCATCAAAGATTCCAGATCTAGACTCTGCAAGGTTAAGGCCTATATACATATACAGAGAAGTCTCACCTTCTATAGCTGCTGTTAGTGATAAGCTCCTCAGATACACAGCTGTGTTGTTTAGCTCAACCACAAGCCGTGATTTAGTTCAGGTGAACATGTAGCAAACTCCTTGTTGACTCCATGAAAACCTATGGAGACAACTCTCCCGTTCACCTAAAATTTTCACCGGCCCACTCTGAACTTTTGGATTTGGAAAATGCATACTCACCTTCAAACCCTTGGTACTCCCAAAGTGCGCTGCGCCTCTGCTTATAGTCTCGCGTCCCTTGGACCATGGGTTTCGAACTGAAGCCTGGCGTGATTTATATTTTATTATATTTAGAGTTTTCTTGCTGCAGCAATTGACAAGAGTGAAATCCAGAAGTCTCACTAATACCTTTTGTGTAGCCATAGTTGGCTACACCAAATGAATACGCAAAGGTCATCAGCCCAAACTGGAACCACAAGTTATTGATAATGAGAAATATCTTGCAGCAGAAAATTATTAAAGTTAACTTCAGATCTTGTATTGATACTTGATTACCCTTCTGGTGTAACCATAGTTGGATGTCACTCCCCTTACCCCTCAGG